DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr21a and Gr22c

DIOPT Version :9

Sequence 1:NP_001259841.1 Gene:Gr21a / 33251 FlyBaseID:FBgn0041250 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_722732.2 Gene:Gr22c / 117499 FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster


Alignment Length:359 Identity:71/359 - (19%)
Similarity:126/359 - (35%) Gaps:101/359 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 VIFISLLFTNFLL-------------PVASWRHGPQVAIFKNMWTNYQYKFFKTTGSPIVF---- 197
            ::|..|:...|||             |.|..|:    ::.:|  |:|      |||...||    
  Fly    47 LLFYGLILNFFLLLKMVCSGGQKLGIPEAFARN----SVLEN--THY------TTGMLAVFSCVV 99

  Fly   198 ---------PNLYPLTWSLCVFSWLLSIAINLSQYFLQPDFRLWYTFAYYPIIAMLNCFCSLWY- 252
                     ..:..|...|.|..:....::|.::.   |.|..:....:..:|.:|..:.|:.| 
  Fly   100 IHFLNFWGSTRVQDLANELLVLEYQQFASLNETKC---PKFNSFVIQKWLSVIGLLLSYLSIAYG 161

  Fly   253 INCNAFGTASRALSDALQTTIR--------GEKPAQKLTEYRHLWV---DLSHMMQQLG------ 300
            :..|.|......::..:|.:..        |     .|..||:||:   .|..|:..|.      
  Fly   162 LPGNNFSVEMVLINSLVQFSFNCNIMHYYIG-----VLLIYRYLWLINGQLLEMVTNLKLDCSVD 221

  Fly   301 ----RAYSNMYG--------MYCLVIFFTTIIATYGSISEIIDHGATYKEVGLFV-----IVFYC 348
                |.|.::|.        |.....:..|::.|.|..|..:   |.|..:.|.:     .::..
  Fly   222 SSRIRKYLSLYRRLLELKGYMVATYEYHMTLVLTTGLASNFL---AIYSWIVLDISMNINFIYLL 283

  Fly   349 MGLLYIICN--------EAHYASRKVGLDFQTKL-LNINLTAVDAATQKEVEMLLVAINKNPPIM 404
            :..|:::.|        .|...:...|...||.| |..:|...|...::.|....:.........
  Fly   284 IFPLFLLVNVWNLWLSIAASDLAENAGKSTQTVLKLFADLEVKDIELERSVNEFALLCGHCQFNF 348

  Fly   405 NLDGYANINR----ELITTNISFMATYLVVLLQF 434
            ::.|...||.    ::|.|  ||:  ||:.::||
  Fly   349 HVCGLFTINYKMGFQMIIT--SFL--YLIYMIQF 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr21aNP_001259841.1 7tm_7 75..438 CDD:285581 71/359 (20%)
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 71/359 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.