DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr21a and Gr36b

DIOPT Version :9

Sequence 1:NP_001259841.1 Gene:Gr21a / 33251 FlyBaseID:FBgn0041250 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster


Alignment Length:250 Identity:59/250 - (23%)
Similarity:103/250 - (41%) Gaps:51/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 LCVFSWLLSIAINLSQYFLQPDFRLWYTFAYYPII-AMLNCF------CSLWYINCNAFGTASRA 264
            ||| |:::::||  ||:||.    :....|.|.|: |.|...      .|...:...||.|....
  Fly   166 LCV-SFIMNLAI--SQHFLV----ILLIRAQYRIMNAKLRMVIEESRRLSFLQLRNGAFMTRCCY 223

  Fly   265 LSDALQTTIRGEKPAQKLTEYRHLWVDLSHMMQQLGRAYSNMYGMYCLVIFFTTIIAT-YGSISE 328
            |||.|:..  ||..:|           |..|:.||...: .|.|:.....::.:|:.| |.|.| 
  Fly   224 LSDQLEDI--GEVQSQ-----------LQSMVGQLDEVF-GMQGLMAYSEYYLSIVGTSYMSYS- 273

  Fly   329 IIDHG--------ATYKEVGLFVIVFY------CMGLLYIICNEAHYASRKVGLDFQTKLLNINL 379
            |..:|        .|...|.:.:.:||      |..:|.::.:...:    :||   .:...:..
  Fly   274 IYKYGPHNLKLSAKTSIIVCILITLFYLDALVNCNNMLRVLDHHKDF----LGL---LEERTVFA 331

  Fly   380 TAVDAATQKEVEMLLVAINKNPPIMNLDGYANINRELITTNISFMATYLVVLLQF 434
            :::|...::..|.|.:.:.:||..:|:.|...|.|.......:.:....:.|:||
  Fly   332 SSLDIRLEESFESLQLQLARNPLKINVMGMFPITRGSTAAMCASVIVNSIFLIQF 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr21aNP_001259841.1 7tm_7 75..438 CDD:285581 58/249 (23%)
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 58/249 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.