DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr21a and Gr59a

DIOPT Version :9

Sequence 1:NP_001259841.1 Gene:Gr21a / 33251 FlyBaseID:FBgn0041250 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster


Alignment Length:364 Identity:71/364 - (19%)
Similarity:127/364 - (34%) Gaps:89/364 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 KFVTSPDKRFDEAIYNVIFISLLFTNF-----LLPVASW-----RHGPQVAIFKNMWTNYQYKFF 188
            ||..|...|....:.|.||::||.:.|     ||..|.|     |..|.:....| :....|...
  Fly    26 KFRQSRITRIYCLLINAIFLTLLPSAFWKSAKLLSTADWMPSYMRVTPYIMCTIN-YAAIAYTLI 89

  Fly   189 K-----------------------TTGSP-------IVFPNLYPLTWS-----LCVF-------S 211
            .                       .||..       :.|...:.||:|     |.||       :
  Fly    90 SRCYRDAMLMDLQRIVLEVNREMLRTGKKMNSLLRRMFFLKTFTLTYSCLSYILAVFIYQWKAQN 154

  Fly   212 WL-----LSIAINLSQYFLQPDFRLWYTFAYYPIIAMLNCFCSLWYINCNAFGTASRALSDALQT 271
            |.     |.:.|:|:..|:.       ||.|         |.|||:| ...:...::.|::.:  
  Fly   155 WSNLCNGLLVNISLTILFVN-------TFFY---------FTSLWHI-ARGYDFVNQQLNEIV-- 200

  Fly   272 TIRGEKPAQKLTEYRHLWV---DLSHMMQQLGRAYS-NMYGMYCLVIFFTTIIATYGSISEIIDH 332
            ..:.....:|..|.|.||.   :||:..:::.:.|. .|..|......|:.|.|..|:|....|.
  Fly   201 ACQSMDLERKSKELRGLWALHRNLSYTARRINKHYGPQMLAMRFDYFIFSIINACIGTIYSTTDQ 265

  Fly   333 GATYKEVGLFVIVFYCMGLLYIICNEAHYASRKVGLDFQTKLLNINLTAVDAATQKEVEMLLVAI 397
            ..:.:::  |..:.|.:.......|:  |....|. ::|   :.....|.:::...|:...|:..
  Fly   266 EPSLEKI--FGSLIYWVRSFDFFLND--YICDLVS-EYQ---MQPKFFAPESSMSNELSSYLIYE 322

  Fly   398 NKNPPIMNLDGYANINRELITTNISFMATYLVVLLQFKI 436
            :.....:.:.|...:|:......:..:..:..:|.||.:
  Fly   323 SSTRLDLLVCGLYRVNKRKWLQMVGSIVVHSSMLFQFHL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr21aNP_001259841.1 7tm_7 75..438 CDD:285581 71/364 (20%)
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 71/364 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.