DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr21a and Gr92a

DIOPT Version :9

Sequence 1:NP_001259841.1 Gene:Gr21a / 33251 FlyBaseID:FBgn0041250 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster


Alignment Length:318 Identity:57/318 - (17%)
Similarity:112/318 - (35%) Gaps:108/318 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 FISLLFTNFLLPVASWRHGPQVAIFKN--MWTNYQYKFFKTTGSPIVFPNLYPLTWSLCVFSWLL 214
            ||.::|  |.|..   |...:....:|  .|.|..::.               :|::...:.::.
  Fly    27 FIGVIF--FCLHT---RKDDKTVFIRNWLKWLNVTHRI---------------ITFTRFFWVYIA 71

  Fly   215 SIAINLSQYFLQ-----------PDFRL---WYTFAYYPIIAMLNCFCSLWYINCNAFGTASRAL 265
            ||:|..:: .||           |:..:   ::.|....||.::|.|..|:           |.:
  Fly    72 SISIKTNR-VLQVLHGMRLVLSIPNVAVILCYHIFRGPEIIDLINQFLRLF-----------RQV 124

  Fly   266 SDALQTTIRGEKPAQKLT-----------EYRHLWVDLSHMMQQLGRAYSNMYGMYC--LVIFFT 317
            ||..:|...|....::|.           |..:||..:     :.|.::..:...:|  .::..|
  Fly   125 SDLFKTKTPGFGGRRELILILLNLISFAHEQTYLWFTI-----RKGFSWRFLIDWWCDFYLVSAT 184

  Fly   318 TIIATYGSISEIIDHGATYKEVGLFVIVFYCMGLLYIICNEAHYASRKVGLDFQTKLLNINLTAV 382
            .|.....||.                  :..:|:||...|:..|.:           |.|.|..:
  Fly   185 NIFIHINSIG------------------YLSLGVLYSELNKYVYTN-----------LRIQLQKL 220

  Fly   383 DAATQKEVEMLLVAINKNPPIMN-LDGYANINRELITTNISFMATYLVVL---LQFKI 436
            :.:..|:         |...:.| |:...::.||:..|:|.|...::.:|   |.:|:
  Fly   221 NTSGSKQ---------KIRRVQNRLEKCISLYREIYHTSIMFHKLFVPLLFLALIYKV 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr21aNP_001259841.1 7tm_7 75..438 CDD:285581 57/318 (18%)
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 57/318 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.