DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr21a and Gr39a

DIOPT Version :9

Sequence 1:NP_001259841.1 Gene:Gr21a / 33251 FlyBaseID:FBgn0041250 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_724330.1 Gene:Gr39a / 117346 FlyBaseID:FBgn0264556 Length:381 Species:Drosophila melanogaster


Alignment Length:414 Identity:79/414 - (19%)
Similarity:140/414 - (33%) Gaps:110/414 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LFQIMGVMPIHRNPPEKNLPRTGYSWGSKQVMWAIFIYSCQT------TIVVLVLRERVKKFVTS 138
            |.:.:|:..|..||.:|....      .:.|:..|..::.|.      :::|...|...|..:|:
  Fly    14 LCRYLGIFCIDYNPTKKKFRL------RRSVLCYIVHFALQAYLVGCISVMVTYWRRCFKSELTT 72

  Fly   139 PDKRFDEAIYNVIFISLLFTNFLLPVASWRHGPQVAIFKN--------------------MW--- 180
            ....||..:..:....|:..|..|   .|...|.:.|.:.                    :|   
  Fly    73 TGNHFDRLVMVIALGILVVQNAWL---IWLQAPHLRIVRQIEFYRRNHLANVRLLLPKRLLWLII 134

  Fly   181 -TN--YQYKFFKTTGSPIVFPNLYPLTWSLCVFSWLLSIAINLSQYFL--QPDFRLWYTFAYYPI 240
             ||  |...|.||                 |:|.||    .:.|:.|:  ...|.|.|....:  
  Fly   135 ATNVVYMANFIKT-----------------CIFEWL----TDASRLFVITSLGFPLRYLVTSF-- 176

  Fly   241 IAMLNCFCSLWYINCNAFGTASRALSDALQTTIRG---EKPAQKLTEYRHLWVDL-----SHMMQ 297
             .|...||.:..:         |.:.|..|:.|..   |....|:|....|.:.:     ..:|.
  Fly   177 -TMGTYFCMVHIV---------RLVLDWNQSQINAIIDESADLKMTSPNRLRLRVCLEMHDRLML 231

  Fly   298 QLGRAYSNMYGMYCL------------VIFFTTIIATYGSISEIIDHGATYKEVGLFVIVFYCMG 350
            ......|.:||....            ||:.|.:|.|..||           .:.|...|.: :.
  Fly   232 LCNDEISLVYGFIAWLSWMFASLDVTGVIYLTMVIQTKKSI-----------VLKLITNVVW-LS 284

  Fly   351 LLYIICNEAHYASRKVGLDF-QTKLLNINLTAVDAATQKEVEMLLVAINKNPPIMNLDGYANINR 414
            ..::.| .|.:.|.:|.:.. :|..:...:........:.:|..|:...:..||:...|:..:::
  Fly   285 PTFMTC-AASFMSNRVTIQANKTAKMLTKVPRTGTGLDRMIEKFLLKNLRQKPILTAYGFFALDK 348

  Fly   415 ELITTNISFMATYLVVLLQFKITE 438
            ..:....:.:.||:|:|:|||..|
  Fly   349 STLFKLFTAIFTYMVILVQFKEME 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr21aNP_001259841.1 7tm_7 75..438 CDD:285581 78/412 (19%)
Gr39aNP_724330.1 7tm_7 8..372 CDD:285581 78/412 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.