DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABA-B-R3 and c11orf49

DIOPT Version :9

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 / 33248 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:NP_001072784.1 Gene:c11orf49 / 780244 XenbaseID:XB-GENE-5808736 Length:330 Species:Xenopus tropicalis


Alignment Length:338 Identity:66/338 - (19%)
Similarity:110/338 - (32%) Gaps:125/338 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 PDGLSELGAATMAVEHINRKRLLPGYTLELVTNDTQCDPGVGVDRFFHAIYTQPSTRMVMLLGSA 233
            |:.||:.||..:|..|:  :..|.....:|:.|..:.:|.....:||...:...|....:|.   
 Frog     3 PERLSQPGAEYLAQRHV--QVYLEDALAQLLENKDEVEPQGSTAKFFAQYFASVSKGTHVLF--- 62

  Fly   234 CSEVTESLAKVVPYWNIVQVSFGSTSPALSDRREFPYFYRTVAPDSSHNPARIAFIRKFGWGTVT 298
                                            |||.:...|     .||  |.:|::.| |....
 Frog    63 --------------------------------REFGFVQIT-----PHN--RASFLKIF-WRCFR 87

  Fly   299 TFSQNEEVHSLAVNNLVTEL-----------EAANI-------SC---------AATITFAATDF 336
            |.::|.::.|:...:.:.::           :||.|       .|         |..|.|..::|
 Frog    88 TIAKNGDLLSMKEYHCLLQILCPDFPEDLTQKAARIVLMDDAMDCLMSFCDFLYAFQIQFYYSEF 152

  Fly   337 KE------QLLLLRETDTRIII---------------GSFSQE--LAPQI------LCEAY---- 368
            .:      |.||..:....:|:               .|.||:  .|||.      |||.|    
 Frog   153 LDTASALYQDLLTGKNANTVIVPTSRSATSRQRQPPSDSSSQDGVDAPQFCQGLESLCERYRHSC 217

  Fly   369 --------------RLRMFGADYAWILH----ESMGAPWWPDQRTACSNHELQLAVENLIVVSTH 415
                          |:..:|...|...|    :|:||  .||:.....:..|...::.||...:.
 Frog   218 PPVPLIGEILSSAPRVSFYGFLMALAKHPGINQSIGA--LPDRAHLLLDELLDKELDRLIAQLST 280

  Fly   416 NSIVGNNVSYSGL 428
            :||..:..|...|
 Frog   281 SSITHSPTSSCAL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361 66/338 (20%)
ANF_receptor 174..568 CDD:279440 63/333 (19%)
7tm_3 633..889 CDD:278433
c11orf49NP_001072784.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.