DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABA-B-R3 and NPR3

DIOPT Version :9

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 / 33248 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:NP_001191304.1 Gene:NPR3 / 4883 HGNCID:7945 Length:541 Species:Homo sapiens


Alignment Length:589 Identity:109/589 - (18%)
Similarity:184/589 - (31%) Gaps:202/589 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 ERRMSPAEMQRNHGKIVLLGLFELSTSRGPRPDG-LSELGAATMAVEHINR--------KRLL-P 192
            ||...|.:      ||.:|.|.       |:.|. |..|.....|:|:..|        :||| |
Human    44 EREALPPQ------KIEVLVLL-------PQDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPP 95

  Fly   193 GYTLELVTNDTQCDPGVG-------VDRFFHAIYTQPSTRMVMLLGSACSEVTESLAKVVPYWNI 250
            |...::...|:.|    |       |||...|...:|.    ::||..|......:|::..:|::
Human    96 GTRFQVAYEDSDC----GNRALFSLVDRVAAARGAKPD----LILGPVCEYAAAPVARLASHWDL 152

  Fly   251 VQVSFGSTSPALSDR-REFPYFYRTVAPDSSHNPARIAFIRKFGW-------------------- 294
            ..:|.|:.:.....: .|:.:..|.....:......:|..|...|                    
Human   153 PMLSAGALAAGFQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTL 217

  Fly   295 ----------GTVTTFSQNEEVHSLAVNNLVTELEAANISCAATITFAATDFKEQLLLLRETDTR 349
                      |..|:....:|...|.:.::|..::|:.                          |
Human   218 EGVHEVFQEEGLHTSIYSFDETKDLDLEDIVRNIQASE--------------------------R 256

  Fly   350 IIIGSFSQELAPQILCEAYRLRMFGADYAWILHE-----SMGAPWWPDQRTACSNHELQLAVENL 409
            ::|...|.:....|:..|:|..|...|||:...|     |.|...|  :|....:.|.:.|..:|
Human   257 VVIMCASSDTIRSIMLVAHRHGMTSGDYAFFNIELFNSSSYGDGSW--KRGDKHDFEAKQAYSSL 319

  Fly   410 IVVSTHNSI----------VGNNVSYSGLNNHMFNSQLRKQSAQFHGQDGFGSGYGSRISIAATQ 464
            ..|:...::          |.::|...|||                                   
Human   320 QTVTLLRTVKPEFEKFSMEVKSSVEKQGLN----------------------------------- 349

  Fly   465 SDSRRRRRRGVGGTSGGHLFPEAISQYAPQTYDAVWAIALALRAAEEHWRRNEEQSKLDGFDYTR 529
                               ..:.::.:....:||:....|||     |.......||.||     
Human   350 -------------------MEDYVNMFVEGFHDAILLYVLAL-----HEVLRAGYSKKDG----- 385

  Fly   530 SDMAWEFLQQMGKLHFLGVSGPVSF-SGPDRVG---TTAFYQIQRGLLEPVALYYPATDALDFRC 590
                .:.:||.....|.|::|.||. :..||.|   ..|...::.|..|.:..|:......:.| 
Human   386 ----GKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVIAMTDVEAGTQEVIGDYFGKEGRFEMR- 445

  Fly   591 PRCRPVKWHSGQVPIAKRVFKLRVAT------------IAPLAFYTIATLSSVGIALAIAFLAFN 643
            |.   ||:..|  |:..|:.:.|:..            :...|...|...:.:|..|.:||..|.
Human   446 PN---VKYPWG--PLKLRIDENRIVEHTNSSPCKSSGGLEESAVTGIVVGALLGAGLLMAFYFFR 505

  Fly   644 LHFR 647
            ..:|
Human   506 KKYR 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361 87/499 (17%)
ANF_receptor 174..568 CDD:279440 80/459 (17%)
7tm_3 633..889 CDD:278433 5/15 (33%)
NPR3NP_001191304.1 PBP1_NPR_C_like 54..446 CDD:107381 89/503 (18%)
ANF_receptor 71..422 CDD:279440 79/454 (17%)
TM_EphA1 476..507 CDD:214014 7/30 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.