DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABA-B-R3 and GPR156

DIOPT Version :9

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 / 33248 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:NP_694547.2 Gene:GPR156 / 165829 HGNCID:20844 Length:814 Species:Homo sapiens


Alignment Length:736 Identity:166/736 - (22%)
Similarity:297/736 - (40%) Gaps:184/736 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   614 VATIAPLAFYTIATLSSVGIALAIAFLAFNLHFRKLKAIKLSSPKLSNITAVGCIFVYATVILLG 678
            :::::|:....:.|..|.|:.|.:.||||.:|.||.:.:|:|||.|:.:|.:|....|::..|.|
Human    42 ISSLSPVLLGIVWTFLSCGLLLILFFLAFTIHCRKNRIVKMSSPNLNIVTLLGSCLTYSSAYLFG 106

  Fly   679 LDHSTLPSAEDSFATVCTARVYLLSAGFSLAFGSMFAKTYRVHRIFTRTGSVFKDK--MLQDIQL 741
            :....:.|   |..|:...|:.:|..|.||.||.:..|::|::::||:.   ..||  :::|:||
Human   107 IQDVLVGS---SMETLIQTRLSMLCIGTSLVFGPILGKSWRLYKVFTQR---VPDKRVIIKDLQL 165

  Fly   742 ILLVGGLLLVDALLVTLWVVTDPMERHLHNLTLEISATDRSV-VYQPQVEVCRSQHTQTWLSVLY 805
            :.||..||:.|.:|:..||:|||:: .|..|::.::.|.:.| ........|.|:::..|:::::
Human   166 LGLVAALLMADVILLMTWVLTDPIQ-CLQILSVSMTVTGKDVSCTSTSTHFCASRYSDVWIALIW 229

  Fly   806 AYKGLLLVVGVYMAWETRHVKIPALNDSQYIGVSVYSVVITSAIVVVLANLISERVTLAFITITA 870
            ..|||||:.|.|:|..|.||..|.:|.|..|.|.|..:|:.:.::.|:...:.....|.|...:.
Human   230 GCKGLLLLYGAYLAGLTGHVSSPPVNQSLTIMVGVNLLVLAAGLLFVVTRYLHSWPNLVFGLTSG 294

  Fly   871 LILTSTTATLCLLFIPKLHDIWARNDIIDPVIHSM---------------GLKMECNTRRFVVDD 920
            .|...||...|.:|||:|.. |...:..:..|..|               |.:..|:.|    .:
Human   295 GIFVCTTTINCFIFIPQLKQ-WKAFEEENQTIRRMAKYFSTPNKSFHTQYGEEENCHPR----GE 354

  Fly   921 RRELQYRVEVQNRVYKKEIQALDAEI----RKLERLLESGLTTTSTTTSSSTSLLTGGGHLKPEL 981
            :..::..:..:|.|    |::|..::    .|:.||:.:..|                 :..|| 
Human   355 KSSMERLLTEKNAV----IESLQEQVNNAKEKIVRLMSAECT-----------------YDLPE- 397

  Fly   982 TVTSGISQTPAASKNR-TPSISGILPNLLLSVLPPVIPRASWPSAEYMQIPMRRSVTFASQPQLE 1045
                | :..||:|.|: ..:::.:          ..:..|..||.....        |.:.|.  
Human   398 ----G-AAPPASSPNKDVQAVASV----------HTLAAAQGPSGHLSD--------FQNDPG-- 437

  Fly  1046 EACLPAQDLINLRLAHQQATEAKTGLINRLRGIFSRTTSSNKGSTASLADQKGLKAAFKSHMGLF 1110
               :.|:|        .|.|...:.....|.|. .:.:|.:.|....::|.|.    |..|:...
Human   438 ---MAARD--------SQCTSGPSSYAQSLEGP-GKDSSFSPGKEEKISDSKD----FSDHLDSG 486

  Fly  1111 TRLIPSSQTA----SCNAIYNNPNQDSIPSEASSHP-NGNHL----KPIHRGSLTKS--GTHLDH 1164
            ....|.::.:    ..:.:..||:|..:|....|.| ...||    :|..|.|...|  ...|..
Human   487 CSQKPWTEQSLGPERGDQVPMNPSQSLLPERGGSDPQRQRHLENSEEPPERRSRVSSVIREKLQE 551

  Fly  1165 LTKD---------------------------PNFLPIPTISG----------------------- 1179
            :.:|                           |..:|:....|                       
Human   552 VLQDLGLGPEASLSTAPSCHQQTWKNSAAFSPQKMPLSKELGFSPYMVRRRRAAQRARSHFPGSA 616

  Fly  1180 ----GEQGDQTLGGKYVKLLETKVNFQLPSNRRPSVVQQPPSLRERVRGSPRFPHRILPPTCSLS 1240
                |.:.::|:.|.:.:|       .:.:...||:..|....|.| |.|.|.|.  ||      
Human   617 PSSVGHRANRTVPGAHSRL-------HVQNGDSPSLAPQTTDSRVR-RPSSRKPS--LP------ 665

  Fly  1241 ALAESEDRPGDSTSILGSCKS 1261
              ::.:||||   ::.||.:|
Human   666 --SDPQDRPG---TLEGSKQS 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361
ANF_receptor 174..568 CDD:279440
7tm_3 633..889 CDD:278433 83/258 (32%)
GPR156NP_694547.2 7tm_3 71..312 CDD:278433 78/247 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 422..545 30/148 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 557..724 25/146 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 769..792
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.