DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABA-B-R3 and frs2

DIOPT Version :9

Sequence 1:NP_001245826.1 Gene:GABA-B-R3 / 33248 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster
Sequence 2:NP_001128281.1 Gene:frs2 / 100038035 XenbaseID:XB-GENE-479760 Length:509 Species:Xenopus tropicalis


Alignment Length:445 Identity:85/445 - (19%)
Similarity:150/445 - (33%) Gaps:163/445 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   930 VQNRVYKKEIQALDAEIRKLERLLESGLTTTSTTTSSSTSLLTGGGHLKPELTVTSGISQTPAAS 994
            :|..:....|..::..:  :||..::.|....|..:.:|...:|.|       |.:|..:.|:..
 Frog   101 LQEIMQNNSISVVEEPV--VERNPQTELDVPRTPRTPTTPGFSGSG-------VPNGYPRYPSFG 156

  Fly   995 K------NRTPSISGILPNLLLSVLPPVIPRASWPSAEYMQIPMRRSVTFASQPQLEE------A 1047
            :      :|.||:..       :.||.|...::.|    :.:|.....|:.:...::|      .
 Frog   157 EASSHPSSRHPSVGS-------TRLPSVGEESTHP----LLVPEDHVHTYVNTSGVQEDQKQRPN 210

  Fly  1048 CLPAQDLI--NLRLAH-------------------------------QQATEAKTGLINRLRGIF 1079
            ..|||::.  ||.:.|                               :|..|.|     :|..:.
 Frog   211 IPPAQEVCVSNLEVIHGHSEPAVPERDPQVILEPEGVKFVLGPTPVQRQLMEKK-----KLEKLE 270

  Fly  1080 SRTTSSN----------KGSTASLADQK----GLKAAFKSHMGLFT--------RLIPSSQTASC 1122
            ....|.|          :|.|...:|::    |.|..:::..||..        |::|...|...
 Frog   271 QNQASVNNGESSCPNNTEGDTGYDSDERRETPGNKMVYENLNGLSISSSGVRRGRVVPPIPTDIQ 335

  Fly  1123 N---------AIYNNPNQDSIP-----------SEASSHP-----NGNH--LKPIHRGSLTKSGT 1160
            |         |:.|..|..|:|           .:.|..|     ||.|  |.|:|....|::.|
 Frog   336 NVNNSAQRRTALINYENLPSLPPVWETRKPSREEDESLGPKTPSLNGFHSNLDPMHNYVNTENVT 400

  Fly  1161 HLDHLTKDPNFLPIPT--ISGGEQGDQTLGGKYVKLLETKVNFQLPSNRRPSVVQ-QPPSLRERV 1222
                       :|:..  :....:.|.|         .|..||.:   ||||:.| |...::..:
 Frog   401 -----------VPLSAHKVEFSRRRDCT---------PTVFNFDI---RRPSLEQRQLNYIQVDL 442

  Fly  1223 RG--------SPRFPHRILPPT----CSLSALAESEDRPGDSTSILGSC-KSIPR 1264
            .|        :|:.|...||.|    ..|.|:.:.|     .|:.:.:. |::||
 Frog   443 EGGSDSDNPQTPKTPTTPLPQTPTRRTELYAVIDIE-----RTAAMSNLQKALPR 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361
ANF_receptor 174..568 CDD:279440
7tm_3 633..889 CDD:278433
frs2NP_001128281.1 PTB_FRS2 15..106 CDD:269913 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.