DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ds and Pcdhb19

DIOPT Version :9

Sequence 1:NP_001285551.1 Gene:ds / 33245 FlyBaseID:FBgn0284247 Length:3556 Species:Drosophila melanogaster
Sequence 2:NP_444374.2 Gene:Pcdhb19 / 93890 MGIID:2136757 Length:801 Species:Mus musculus


Alignment Length:806 Identity:218/806 - (27%)
Similarity:334/806 - (41%) Gaps:176/806 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 ILLAIVLLGSSQAASHDQERERKLEVFEGVAVDYQIG-YIGDFG-GIDSGPPYIIVAEAGVETD- 122
            :||..|.||.|||.|    ...:|.|.|.:.....:| .:.|.| .:|.    :...||.|.:. 
Mouse    14 VLLLFVFLGMSQAHS----EAGRLSVVEEMLSGALVGNLVKDLGLQVDE----LSAREAQVASSD 70

  Fly   123 ----LAIDRATGEIRTKVKLDRETRASYS---------LVAIPLSGRNIRVLVTVKDENDNAPTF 174
                |.::..||::.....||||.....:         |:..||  :.::..:.|.|.|||:|.|
Mouse    71 NKLPLQLNINTGDLLLSEPLDREELCGSTEPCVLHFQVLLKNPL--KILQAELQVTDVNDNSPVF 133

  Fly   175 PQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQ 239
            .:..|.:|.|||:|......|..|.|||:.....:.|.|   :.|..|.::.....||..|.:|.
Mouse   134 LEKEMVLEIPENSPVGAVFLLESAIDLDVGINAVKSYEI---SQNSHFHVTMRVNPDGRKYPELV 195

  Fly   240 ISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTS 304
            :...||.|......|::.||||||||..|...|.:.:.|:|||.|.|:...|..|||||:.:|:.
Mouse   196 LDKALDYEEQHELRLILTALDGGTPPRSGTALVRVEVIDINDNSPEFDHMFYEVTVPENSMLGSL 260

  Fly   305 VLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHG 369
            ::...|.|.|:..||.|.||.:....|..:.|.|:..:|.|.:...|||||.|.:.:::.|.|.|
Mouse   261 LITASAWDLDSGINGEVSYAFSHASEDIRKTFAINEHSGEIRLKGYLDFETTESYSIIIKATDRG 325

  Fly   370 EQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVN 434
              .|...:.|.|:|.|||||.|.   |.:|...||....:|:  ..|...|:.|.|| .|...:.
Mouse   326 --GLFGKSTVRIQVMDVNDNFPE---IIVSSFISPIPENTAE--TLVMIFSIRDKDS-GENGKMV 382

  Fly   435 VTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVND 499
            .|:..| ..|.|.:...:.|.:.....||||.::.|.:::..||.|||.|....:|.:::.|:||
Mouse   383 CTIPEG-LPFVLKSSIENYYHLETDGALDRESIAEYNITISVTDLGTPRLTTQHTIIVQVADIND 446

  Fly   500 NPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLIT 564
            |.|.|.|..|.....|...|...:..:.|.|.|.|.|:.:||||                     
Mouse   447 NAPAFTQTSYTMFFHENNSPALHIGTISATDSDAGSNAHITYSL--------------------- 490

  Fly   565 TRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRC 629
                                                                             
Mouse   491 ----------------------------------------------------------------- 490

  Fly   630 ILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRG- 693
               :||.|....::::::              :.:.:|::.....||:|...::||.|.||||| 
Mouse   491 ---MSAQDLQMALSSLIS--------------INADNGQLFALRALDYEVLQAFEFQVGATDRGS 538

  Fly   694 -GLSTTAMIKMQLTDVNDNRP-VFYPREYKVSLRESPKASSQASSTP--------------IVAV 742
             .||:.|::::.:.|.|||.| |.||              .|.:|.|              :..|
Mouse   539 PALSSQALVRVVVLDDNDNAPFVLYP--------------MQNASAPCTELLPRAAEPGYLVTKV 589

  Fly   743 VATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRS 807
            ||.|.|.|....:|::::...|.|:|.:....||:...|  :||.|..|.|.|.:...|.|:...
Mouse   590 VAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTR--LLSERDAPKHRLLLLVKDNGDPPR 652

  Fly   808 NADAVVFLSIIDAMQRP--PIFEKAR 831
            :|...:.:.::|...:|  |:.|.||
Mouse   653 SASVTLHVLVVDGFSQPYLPLPEVAR 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsNP_001285551.1 CA 111..172 CDD:214520 18/74 (24%)
Cadherin_repeat 178..282 CDD:206637 35/103 (34%)
Cadherin_repeat 291..389 CDD:206637 36/97 (37%)
Cadherin_repeat 406..500 CDD:206637 26/93 (28%)
Cadherin_repeat 509..607 CDD:206637 12/97 (12%)
Cadherin_repeat 616..711 CDD:206637 20/96 (21%)
Cadherin_repeat 719..820 CDD:206637 25/114 (22%)
Cadherin_repeat 832..927 CDD:206637 218/806 (27%)
Cadherin_repeat 937..1032 CDD:206637
Cadherin_repeat 1040..1149 CDD:206637
Cadherin_repeat 1158..1252 CDD:206637
Cadherin_repeat 1263..1361 CDD:206637
Cadherin_repeat 1369..1481 CDD:206637
Cadherin_repeat 1489..1598 CDD:206637
Cadherin_repeat 1614..1710 CDD:206637
Cadherin_repeat 1723..1843 CDD:206637
Cadherin_repeat 1853..1948 CDD:206637
Cadherin_repeat 1957..2053 CDD:206637
Cadherin_repeat 2061..2154 CDD:206637
Cadherin_repeat 2170..2318 CDD:206637
Cadherin_repeat 2326..2424 CDD:206637
Cadherin_repeat 2434..2528 CDD:206637
Cadherin_repeat 2549..2641 CDD:206637
Cadherin_repeat 2652..2748 CDD:206637
Cadherin_repeat 2758..2858 CDD:206637
Cadherin_repeat 2866..2960 CDD:206637
Cadherin_repeat 2985..3071 CDD:206637
Pcdhb19NP_444374.2 Cadherin_2 32..112 CDD:285466 18/83 (22%)
Cadherin_repeat 137..238 CDD:206637 35/103 (34%)
Cadherin_repeat 247..343 CDD:206637 36/97 (37%)
Cadherin_repeat 356..447 CDD:206637 26/94 (28%)
Cadherin_repeat 455..557 CDD:206637 32/204 (16%)
Cadherin_repeat 576..664 CDD:206637 22/89 (25%)
Cadherin_C_2 687..769 CDD:293101
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I9496
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.