DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ds and Pcdhb17

DIOPT Version :9

Sequence 1:NP_001285551.1 Gene:ds / 33245 FlyBaseID:FBgn0284247 Length:3556 Species:Drosophila melanogaster
Sequence 2:NP_444372.2 Gene:Pcdhb17 / 93888 MGIID:2136754 Length:799 Species:Mus musculus


Alignment Length:821 Identity:221/821 - (26%)
Similarity:333/821 - (40%) Gaps:206/821 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 ILLAIVLLGSSQAA------SHDQERERKLEVFEGVAVDYQIGYIGDFG---GID----SGPPYI 112
            :|...|||..|.|.      |.::|.||.             .::.:.|   |:|    |.....
Mouse    14 VLAFFVLLHVSGAGAELGPYSIEEETERG-------------SFVANLGKDLGVDLAEISNRRAR 65

  Fly   113 IVAEAGVETDLAIDRATGEIRTKVKLDRETRAS---------YSLVAIPLS--GRNIRVLVTVKD 166
            |:::...| .|.::..:|::....|||||....         ..|:..||.  ...:||:    |
Mouse    66 IISQENKE-HLQLNLQSGDLLINEKLDREELCGPIEPCVLHFQVLMENPLEVFQAELRVM----D 125

  Fly   167 ENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERD 231
            .||.:|.|.:..|.:...||:.......|..|.|.|:...|.|.|.:.|   |..|.:.:....|
Mouse   126 INDYSPVFSEREMILRILENSALGDTFPLNNALDSDVAINNIQTYRLSS---NSHFLVVTRNRSD 187

  Fly   232 GVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVP 296
            |..|.:|.:...||||..|...|.:.|||||.||..|...|.|.:.|:|||.|.|.|..|...:|
Mouse   188 GRKYPELVLEKELDREEEPELRLTLTALDGGAPPRSGTAQVLIEVVDINDNAPKFQQPTYRVQIP 252

  Fly   297 ENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHEL 361
            ||:..|:.||.|.|:|.|:.:.|.|.||:::...|..:...::|.||.|.:.|.:||||...:|:
Mouse   253 ENSPTGSLVLTVSANDLDSGDYGKVLYALSQPSEDISKTLEVNPVTGEIRLRKEVDFETIPSYEV 317

  Fly   362 VVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDS 426
            .:.|.|.|  .|.....:.::|.|||||.|.   :.||...|| :.|:: |.|.||..||.||||
Mouse   318 DIKATDGG--GLSGKCTLLLKVVDVNDNAPE---VMLSALTSP-VPENS-PDEVVAVFSVKDPDS 375

  Fly   427 KTEYANVNVTLNG-------GDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPL 484
                ||     ||       .|..|.|.:...:.|.::....||||....|.:::..:|.|||.|
Mouse   376 ----AN-----NGKMIASIEEDLPFLLKSSGKNFYTLVTKRALDREEREKYNITITVSDLGTPRL 431

  Fly   485 HASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPET 549
            ....:|.::::|.|||.|.|.|..|...|.|...|...:..:.|.|.|.|.||.::|||..    
Mouse   432 TTQHTITVQVSDTNDNAPAFNQTSYTLFVRENNSPAMHIGTISATDSDAGSNSHISYSLLP---- 492

  Fly   550 HAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQS 614
                             ||                                              
Mouse   493 -----------------SH---------------------------------------------- 494

  Fly   615 FYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFER 679
                                  ||...::::::              :.:.:|::.....||:|.
Mouse   495 ----------------------DPQLALDSLIS--------------INADNGQLFALRALDYEA 523

  Fly   680 RSSYEFPVLATDRG--GLSTTAMIKMQLTDVNDNRP-VFYPREYKVSLRESPKASSQASSTP--- 738
            ..::||.|.|.|:|  .||:.|::::.:.|.|||.| |.||              .|.||.|   
Mouse   524 LQAFEFHVGAIDQGSPALSSQALVRVVVLDDNDNAPFVLYP--------------MQNSSAPCTE 574

  Fly   739 -----------IVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPM 792
                       :..|||.|.|.|....:|::::...|.|:|.:....||:...|  :||.|..|.
Mouse   575 LLPRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTR--LLSERDVPK 637

  Fly   793 HMLNISATDGGNLRSNADAVVFLSIIDAMQRP--PIFEKAR 831
            |.|.:...|.|:...:|...:.:.::|...:|  |:.|.||
Mouse   638 HRLVLLVKDNGDPPRSASVTLHVLVVDGFSQPYLPLPEVAR 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsNP_001285551.1 CA 111..172 CDD:214520 17/71 (24%)
Cadherin_repeat 178..282 CDD:206637 35/103 (34%)
Cadherin_repeat 291..389 CDD:206637 34/97 (35%)
Cadherin_repeat 406..500 CDD:206637 32/100 (32%)
Cadherin_repeat 509..607 CDD:206637 15/97 (15%)
Cadherin_repeat 616..711 CDD:206637 17/96 (18%)
Cadherin_repeat 719..820 CDD:206637 26/114 (23%)
Cadherin_repeat 832..927 CDD:206637 221/821 (27%)
Cadherin_repeat 937..1032 CDD:206637
Cadherin_repeat 1040..1149 CDD:206637
Cadherin_repeat 1158..1252 CDD:206637
Cadherin_repeat 1263..1361 CDD:206637
Cadherin_repeat 1369..1481 CDD:206637
Cadherin_repeat 1489..1598 CDD:206637
Cadherin_repeat 1614..1710 CDD:206637
Cadherin_repeat 1723..1843 CDD:206637
Cadherin_repeat 1853..1948 CDD:206637
Cadherin_repeat 1957..2053 CDD:206637
Cadherin_repeat 2061..2154 CDD:206637
Cadherin_repeat 2170..2318 CDD:206637
Cadherin_repeat 2326..2424 CDD:206637
Cadherin_repeat 2434..2528 CDD:206637
Cadherin_repeat 2549..2641 CDD:206637
Cadherin_repeat 2652..2748 CDD:206637
Cadherin_repeat 2758..2858 CDD:206637
Cadherin_repeat 2866..2960 CDD:206637
Cadherin_repeat 2985..3071 CDD:206637
Pcdhb17NP_444372.2 Cadherin_2 33..112 CDD:285466 18/92 (20%)
Cadherin_repeat 137..238 CDD:206637 35/103 (34%)
Cadherin_repeat 246..343 CDD:206637 34/98 (35%)
Cadherin_repeat 356..447 CDD:206637 32/100 (32%)
Cadherin_repeat 455..557 CDD:206637 32/204 (16%)
Cadherin_repeat 576..664 CDD:206637 22/89 (25%)
Cadherin_C_2 687..770 CDD:293101
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I9496
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.