DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ds and Pcdhb12

DIOPT Version :9

Sequence 1:NP_001285551.1 Gene:ds / 33245 FlyBaseID:FBgn0284247 Length:3556 Species:Drosophila melanogaster
Sequence 2:NP_444367.1 Gene:Pcdhb12 / 93883 MGIID:2136747 Length:789 Species:Mus musculus


Alignment Length:877 Identity:247/877 - (28%)
Similarity:392/877 - (44%) Gaps:179/877 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   729 KASSQA---------SSTPIVAVVATD-----PDYGNFG-QVSYRIVAGNEAGIFRIDRSTGEIF 778
            |:.|:|         .|..:||.||.|     .:....| |:.||   ||:. :.::|..||.:|
Mouse    18 KSDSEAIRYSMPEEKESGYLVANVAKDLGLRVEELATRGAQIHYR---GNKE-LLQMDAETGNLF 78

  Fly   779 V---VRPDMLSVRTQP--MHMLNISATDGGNLRSNADAVVF----LSIIDAMQRPPIFEKARYNY 834
            :   :..:.|...|:|  :|...|.          .:.|.|    |.:.|.....|.|.......
Mouse    79 LKEKLDREALCGATEPCVLHFQIIL----------ENPVQFFQTELQLTDINDHSPEFSDTEMLL 133

  Fly   835 YVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGN-------IRIAKPLDH 892
            .:.|:...|||.....|...|:...:...|::   :|:.:|.:.|.|.:       :.:.:.||.
Mouse   134 TIPENAQPGTVFPLKAAHDSDIGSNAVQNYTV---NPNIHFHVVTLSRSDGRKYPELVLDRALDR 195

  Fly   893 EAKSQVLLNIQA-TLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAH 956
            |.:.::.|.:.| ..|.||..|.|:|:|||.|:|||||:|..|:..:.|||::.|.|.:....|.
Mouse   196 EEQPELTLTLTALDGGSPPRSGTTEVHIEVVDINDNAPQFIQSLYEVQVPENSPLNALVVMVSAT 260

  Fly   957 DKDSGSSGQVTYSLVKESGKGL---FAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLST 1018
            |.|:|..|.|.|||.:  |.||   |.||..:|.:.|::.||:|.|..:|:.:.|||||  .||.
Mouse   261 DLDAGIYGNVAYSLFQ--GDGLSQPFVIDKITGEIRLTKELDFEVSHHYTIEIAATDGG--GLSG 321

  Fly  1019 NLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNV 1083
            ..|:::.|.|||||.|.....:.:|.|.|: |....:...:.||.|:|:|.||        |.::
Mouse   322 KCTVVIQVLDVNDNAPELAIRKLTVPVPEN-SAETVVAVFSVSDSDSGDNGRI--------VCSI 377

  Fly  1084 TNSISSSDVSQHFGI---FPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLD 1145
            .|:|.       |.:   |.|...:....|||||:|..|.:|:...|.|||....:..:.|:|.|
Mouse   378 QNNIP-------FLLKPTFENYYTLVTEGPLDRESRAEYNITITVWDLGTPRLTTQHTITVQVAD 435

  Fly  1146 ANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLP-------INSSFQVHP 1203
            .|||.|.|.::.|...::||......:|.::|:|.|.|.||.|.|||||       :.|...::.
Mouse   436 INDNAPAFTQTSYTLFVQENNSPALHIGTISATDSDSGSNAHITYSLLPPHDSQLALASLVSINS 500

  Fly  1204 VTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVRE 1268
            ..|::.....:|.|:.:.::|.|:|.|.|:|..|::..||:.|.|.|||:|.:..|.::..:...
Mouse   501 DNGQLFALRAMDYEMLQAFELHVDATDGGSPALSSQALVRVVVLDDNDNSPFVLYPMQNASAPCT 565

  Fly  1269 E-----QPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEER 1328
            |     ..||..:.:|.|||||.||||.:::.::|..:.   ||||:...:|.:||..:|...:.
Mouse   566 ELLPRAAEPGYLITKVVAVDRDSGQNAWLSFQLLKATEP---GLFSVWAHNGEVRTTRLLSERDA 627

  Fly  1329 SIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERP 1393
            ..::|.:...|.|:|||.....|.|.|:|                           |...|....
Mouse   628 PKHKLLLLVKDNGDPPRSASVTLHVLVVD---------------------------GFSQPYLPL 665

  Fly  1394 ADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDT 1458
            .:|.|:|.::.: |:...|                      ||||.   ..|.|.|.|.:...  
Mouse   666 PEVARDSTQDDY-DVLTLY----------------------LVVAL---ASVSSLFLLSVLLF-- 702

  Fly  1459 TASNNPQSSAITVKI----EVADVND-NAPE--WPQDPIDLQVSEATPVGTIIHNF---TATDAD 1513
                      :.|::    ..|.:.| :.||  :|...:|  ||.|   ||:..::   ...:..
Mouse   703 ----------VGVRLCRRARAASLGDYSVPEGHFPSHLVD--VSRA---GTLSQSYQYEVCLNGG 752

  Fly  1514 TGTNGDLQYRLIR-YFPQL-----NESQEQAM 1539
            ||||   ::..:: .||.|     .|.:|.|:
Mouse   753 TGTN---EFNFLKPLFPILPTQAAAEERENAV 781

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsNP_001285551.1 CA 111..172 CDD:214520
Cadherin_repeat 178..282 CDD:206637
Cadherin_repeat 291..389 CDD:206637
Cadherin_repeat 406..500 CDD:206637
Cadherin_repeat 509..607 CDD:206637
Cadherin_repeat 616..711 CDD:206637
Cadherin_repeat 719..820 CDD:206637 27/114 (24%)
Cadherin_repeat 832..927 CDD:206637 27/102 (26%)
Cadherin_repeat 937..1032 CDD:206637 39/97 (40%)
Cadherin_repeat 1040..1149 CDD:206637 33/111 (30%)
Cadherin_repeat 1158..1252 CDD:206637 32/100 (32%)
Cadherin_repeat 1263..1361 CDD:206637 32/102 (31%)
Cadherin_repeat 1369..1481 CDD:206637 18/116 (16%)
Cadherin_repeat 1489..1598 CDD:206637 16/60 (27%)
Cadherin_repeat 1614..1710 CDD:206637
Cadherin_repeat 1723..1843 CDD:206637
Cadherin_repeat 1853..1948 CDD:206637
Cadherin_repeat 1957..2053 CDD:206637
Cadherin_repeat 2061..2154 CDD:206637
Cadherin_repeat 2170..2318 CDD:206637
Cadherin_repeat 2326..2424 CDD:206637
Cadherin_repeat 2434..2528 CDD:206637
Cadherin_repeat 2549..2641 CDD:206637
Cadherin_repeat 2652..2748 CDD:206637
Cadherin_repeat 2758..2858 CDD:206637
Cadherin_repeat 2866..2960 CDD:206637
Cadherin_repeat 2985..3071 CDD:206637
Pcdhb12NP_444367.1 Cadherin_2 24..105 CDD:285466 21/94 (22%)
Cadherin_repeat 133..231 CDD:206637 27/100 (27%)
Cadherin_repeat 240..335 CDD:206637 39/98 (40%)
Cadherin_repeat 345..439 CDD:206637 33/109 (30%)
Cadherin_repeat 447..549 CDD:206637 32/101 (32%)
Cadherin_repeat 568..656 CDD:206637 30/90 (33%)
Cadherin_C_2 680..762 CDD:293101 25/126 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I9496
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.