DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ds and Pcdhb8

DIOPT Version :9

Sequence 1:NP_001285551.1 Gene:ds / 33245 FlyBaseID:FBgn0284247 Length:3556 Species:Drosophila melanogaster
Sequence 2:NP_444363.1 Gene:Pcdhb8 / 93879 MGIID:2136742 Length:779 Species:Mus musculus


Alignment Length:827 Identity:227/827 - (27%)
Similarity:332/827 - (40%) Gaps:201/827 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LILLAIVLL---GSSQAASHDQERERKLEVFEGVAVDYQIGYI-----GDFGGIDSGPPYIIVAE 116
            :|.|||:||   .||:|.|:....|.            :.||:     .|.|        :.|.|
Mouse    14 VIFLAILLLLWEASSEAISYSMPEET------------ESGYLVANLAQDLG--------LRVGE 58

  Fly   117 A----------GVETDLAIDRATGEIRTKVKLDRETRASYS---------LVAIPLSGRNIRVLV 162
            .          |.:..|.:|...|.:..|.|.|||.....:         ::..|:......:..
Mouse    59 LTTRGARIHHNGNKELLQLDAERGNLLLKEKPDREALCGATEPCVLHFQIILENPVQFFQTDLQF 123

  Fly   163 TVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSH 227
            |  |.||:.|.||.|.|.::..|.........|..|:|.|:.....|.|. ||.|::  |.:.:.
Mouse   124 T--DINDHFPEFPDTEMLLKIQEIAQPGTVFPLKAAQDPDIGSNAVQNYT-VSPNLH--FHVVTL 183

  Fly   228 RERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYF 292
            ...|...|.:|.:...||||..|..:|::.|||||.||..|..||.|.:.|:|||.|.|.||.|.
Mouse   184 SRSDDRKYPELVLDRALDREEQPELTLILTALDGGAPPKSGTTTVRIEVVDINDNAPQFLQSLYA 248

  Fly   293 ATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKE 357
            ..||||:.:...|:.|.|.|.||..:|.|.|:: .:.....|.|.||..||.|.:..|||||...
Mouse   249 VEVPENSPLNALVVTVSARDLDAGIHGNVAYSL-FQGGGGPQPFVIDEITGEIRLKGALDFEATS 312

  Fly   358 LHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVH 422
            .:.:.:||.|.|  .|.....|:|:|.|||||.|.:.:..|:.    .|.|:| |...||..||.
Mouse   313 YYTMEIVATDSG--GLSGKCTVAIQVLDVNDNAPKLTISSLTS----SIPENA-PEAVVAVFSVS 370

  Fly   423 DPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHAS 487
            ||||......|....||..  |.|.....:.|.::...|||||..:.|.:::..:|.|||.|...
Mouse   371 DPDSGDNGRMVCSIQNGLP--FLLKPTFKNFYTLVTERPLDRESNAEYNITITVSDLGTPRLTTQ 433

  Fly   488 KSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQ 552
            .:|.::::|:|||.|.|.|..|...|.|...|...:..:.|.|.|.|.|..:.|||         
Mouse   434 HTITVQVSDINDNAPAFTQTSYTLFVHENNSPALHIGTISATDSDSGSNGLIIYSL--------- 489

  Fly   553 WFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYN 617
                                               :||                           
Mouse   490 -----------------------------------LPP--------------------------- 492

  Fly   618 VSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSS 682
                              .|...|:.::::              :.|.:|::.....||:|...:
Mouse   493 ------------------HDQQLGLASLIS--------------INSDNGQLFALRALDYEALQA 525

  Fly   683 YEFPVLATDRG--GLSTTAMIKMQLTDVNDNRP-VFYPREYKVSLRESPKASSQASSTP------ 738
            :||.|.|||||  .||:.|::::.:.|.|||.| |.||              .|.:|.|      
Mouse   526 FEFHVGATDRGSPALSSEALVRVVVLDDNDNAPFVLYP--------------LQNASAPCTELLP 576

  Fly   739 --------IVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHML 795
                    |..|||.|.|.|....:|::::...|.|:|.:....||:...|  :||.|..|.|.|
Mouse   577 RAAEPGYLITKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTR--LLSERDAPKHRL 639

  Fly   796 NISATDGGNLRSNADAVVFLSIIDAMQRP--PIFEKARYNYYVKEDI 840
            .:...|.|....:|..::.:.::|...:|  |:.|.| .|...:||:
Mouse   640 LLLVKDNGEPLRSASVMLQVLVVDGFSQPYLPLPEVA-LNPTQEEDM 685

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsNP_001285551.1 CA 111..172 CDD:214520 16/79 (20%)
Cadherin_repeat 178..282 CDD:206637 34/103 (33%)
Cadherin_repeat 291..389 CDD:206637 37/97 (38%)
Cadherin_repeat 406..500 CDD:206637 32/93 (34%)
Cadherin_repeat 509..607 CDD:206637 14/97 (14%)
Cadherin_repeat 616..711 CDD:206637 20/96 (21%)
Cadherin_repeat 719..820 CDD:206637 26/114 (23%)
Cadherin_repeat 832..927 CDD:206637 3/9 (33%)
Cadherin_repeat 937..1032 CDD:206637
Cadherin_repeat 1040..1149 CDD:206637
Cadherin_repeat 1158..1252 CDD:206637
Cadherin_repeat 1263..1361 CDD:206637
Cadherin_repeat 1369..1481 CDD:206637
Cadherin_repeat 1489..1598 CDD:206637
Cadherin_repeat 1614..1710 CDD:206637
Cadherin_repeat 1723..1843 CDD:206637
Cadherin_repeat 1853..1948 CDD:206637
Cadherin_repeat 1957..2053 CDD:206637
Cadherin_repeat 2061..2154 CDD:206637
Cadherin_repeat 2170..2318 CDD:206637
Cadherin_repeat 2326..2424 CDD:206637
Cadherin_repeat 2434..2528 CDD:206637
Cadherin_repeat 2549..2641 CDD:206637
Cadherin_repeat 2652..2748 CDD:206637
Cadherin_repeat 2758..2858 CDD:206637
Cadherin_repeat 2866..2960 CDD:206637
Cadherin_repeat 2985..3071 CDD:206637
Pcdhb8NP_444363.1 Cadherin_2 31..112 CDD:285466 17/100 (17%)
Cadherin_repeat 140..238 CDD:206637 33/100 (33%)
Cadherin_repeat 247..342 CDD:206637 37/97 (38%)
Cadherin_repeat 354..446 CDD:206637 32/94 (34%)
Cadherin_repeat 454..556 CDD:206637 34/204 (17%)
Cadherin_repeat 575..663 CDD:206637 23/89 (26%)
Cadherin_C_2 686..766 CDD:293101 227/827 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I9496
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.