DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ds and Pcdhb7

DIOPT Version :9

Sequence 1:NP_001285551.1 Gene:ds / 33245 FlyBaseID:FBgn0284247 Length:3556 Species:Drosophila melanogaster
Sequence 2:NP_444362.3 Gene:Pcdhb7 / 93878 MGIID:2136741 Length:829 Species:Mus musculus


Alignment Length:809 Identity:216/809 - (26%)
Similarity:335/809 - (41%) Gaps:176/809 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LHPSHMLRSSLLILLAIVLLGSSQAASHDQERERKLEVFEGVAVDYQIGYIGDFGGIDSGPPYII 113
            |..:|..|..:..:..:||:   |..|....:...||..|..:.   :.::....|:  |...:.
Mouse    35 LEKAHPKRQVIAFIFMMVLV---QVCSEPTTQYSILEETESGSF---VAHLAKDLGL--GARELA 91

  Fly   114 VAEAGVETD-----LAIDRATGEIRTKVKLDRETRAS-------YSLVAIPLSGRNIRVLVTVKD 166
            ...|.|.:|     |.:|..||::..:.|:|||...|       :..|.:....:..:..:.::|
Mouse    92 ARSARVVSDDYKQRLLLDPETGDLLLREKVDREEVCSTVDPCVLHFQVTLEKPVQYFQGELLIQD 156

  Fly   167 ENDNAPTFPQTSMHIEFPENTPREVKRTLLP---ARDLDLEPYNTQRYNIVSGNVNDAFRLSSHR 228
            .||:||.||:..|.:..|||:.   ..||||   |:|||:.....|:|.:   :.|..|.:.:..
Mouse   157 INDHAPEFPEGEMLLNIPENSQ---PGTLLPLNLAQDLDVGSNGLQQYTV---SPNSHFHVLTRN 215

  Fly   229 ERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFA 293
            ..:|..|.:|.....||||.....||.:.|||||:||..|...|.|.|.|:|||.|.|..|.|..
Mouse   216 NSEGKKYPELVQDRALDREEQAELSLTLIALDGGSPPRSGTALVRILIMDINDNAPEFVNSPYEV 280

  Fly   294 TVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKEL 358
            .|.|::...:.||.|:|.|.||...|.|.|...:...:.::.|.|:..||.|.:.|.||||..:.
Mouse   281 QVLESSLPDSPVLTVFAQDADAGNFGRVSYGFFQASDEIQRTFSINKVTGEIQLKKELDFEKIKF 345

  Fly   359 HELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHD 423
            :.:.:.|.|.|  .|.....|.:.|.|||||.|.:.:..|:.    .:.|:| |...::...|.|
Mouse   346 YHVKIEATDGG--GLSGKGLVIVEVLDVNDNAPELTISSLTS----SVPENA-PETIISIFRVGD 403

  Fly   424 PDSKTEYANVNVTLNGGDG-HFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHAS 487
            .||.   .|..|..:..:. .|.|.:...:.|.::...|||||..:.|.::::.:|.|||.|...
Mouse   404 RDSG---ENAKVVCSIPENLPFILKSTFKNFYTLVTESPLDRESRAEYNITIMVSDLGTPRLTTW 465

  Fly   488 KSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQ 552
            .:|.::::|||||.|.|.:..|...|.|...|...:..:.|.|.|.|.|:.:||||. .|.    
Mouse   466 HTITVQVSDVNDNAPAFTRTSYTMFVRENNSPALHIGTISATDSDSGSNAHITYSLL-LPH---- 525

  Fly   553 WFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYN 617
                ||:.                             ||||    |::|:               
Mouse   526 ----DPEL-----------------------------PLSS----LISIN--------------- 538

  Fly   618 VSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSS 682
               |:|                                           |::.....||:|...:
Mouse   539 ---ADN-------------------------------------------GQLFALRALDYEVLQA 557

  Fly   683 YEFPVLATDRG--GLSTTAMIKMQLTDVNDNRP-VFYPREYKVSLRESPKASSQASSTP------ 738
            :||.|.|||||  .||:.|::::.:.|.|||.| |.||              .|.:|.|      
Mouse   558 FEFHVGATDRGSSALSSQALVRVVVLDDNDNAPFVLYP--------------MQNASAPCTELLP 608

  Fly   739 --------IVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHML 795
                    :..|||.|.|.|....:|::::...|.|:|.:....||:...|  :||.|..|.|.|
Mouse   609 RAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTSR--LLSERDAPKHRL 671

  Fly   796 NISATDGGNLRSNADAVVFLSIIDAMQRP 824
            .:...|.|....:|...:.:.::|...:|
Mouse   672 LMLVKDNGEPPRSASVTLHVLLVDGFSQP 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsNP_001285551.1 CA 111..172 CDD:214520 16/72 (22%)
Cadherin_repeat 178..282 CDD:206637 38/106 (36%)
Cadherin_repeat 291..389 CDD:206637 32/97 (33%)
Cadherin_repeat 406..500 CDD:206637 27/94 (29%)
Cadherin_repeat 509..607 CDD:206637 22/97 (23%)
Cadherin_repeat 616..711 CDD:206637 19/96 (20%)
Cadherin_repeat 719..820 CDD:206637 25/114 (22%)
Cadherin_repeat 832..927 CDD:206637
Cadherin_repeat 937..1032 CDD:206637
Cadherin_repeat 1040..1149 CDD:206637
Cadherin_repeat 1158..1252 CDD:206637
Cadherin_repeat 1263..1361 CDD:206637
Cadherin_repeat 1369..1481 CDD:206637
Cadherin_repeat 1489..1598 CDD:206637
Cadherin_repeat 1614..1710 CDD:206637
Cadherin_repeat 1723..1843 CDD:206637
Cadherin_repeat 1853..1948 CDD:206637
Cadherin_repeat 1957..2053 CDD:206637
Cadherin_repeat 2061..2154 CDD:206637
Cadherin_repeat 2170..2318 CDD:206637
Cadherin_repeat 2326..2424 CDD:206637
Cadherin_repeat 2434..2528 CDD:206637
Cadherin_repeat 2549..2641 CDD:206637
Cadherin_repeat 2652..2748 CDD:206637
Cadherin_repeat 2758..2858 CDD:206637
Cadherin_repeat 2866..2960 CDD:206637
Cadherin_repeat 2985..3071 CDD:206637
Pcdhb7NP_444362.3 Cadherin_2 63..143 CDD:285466 18/84 (21%)
Cadherin_repeat 171..269 CDD:206637 37/103 (36%)
Cadherin_repeat 277..374 CDD:206637 32/98 (33%)
Cadherin_repeat 386..478 CDD:206637 27/95 (28%)
Cadherin_repeat 486..588 CDD:206637 41/204 (20%)
Cadherin_repeat 607..695 CDD:206637 22/89 (25%)
Cadherin_C_2 719..801 CDD:293101
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I9496
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.