DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ds and Pcdhb4

DIOPT Version :9

Sequence 1:NP_001285551.1 Gene:ds / 33245 FlyBaseID:FBgn0284247 Length:3556 Species:Drosophila melanogaster
Sequence 2:NP_444359.3 Gene:Pcdhb4 / 93875 MGIID:2136738 Length:784 Species:Mus musculus


Alignment Length:909 Identity:231/909 - (25%)
Similarity:354/909 - (38%) Gaps:239/909 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LILLAIVLLGSSQAASHDQERERKLEVFEGVAVDYQIGYIGDFGGIDSGPPYIIVAEA-----GV 119
            |.:|.::.:..|:|..:....|.:        ..|.:..:....||..|.  :...||     |.
Mouse    17 LTMLLLLWVSGSEAIKYSMPEETE--------SGYLVANLAQDLGIRVGE--LAAREARVHHRGN 71

  Fly   120 ETDLAIDRATGEIRTKVKLDRETRASYS---------LVAIPLSGRNIRVLVTVKDENDNAPTFP 175
            :..|.:|..||.:..|.|||||.....:         ::..|:......:.:|  |.||::|.||
Mouse    72 KDLLQLDAETGNLFLKEKLDREGLCGATEPCVLHFQIILKNPVQFFQTELQLT--DINDHSPEFP 134

  Fly   176 QTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQI 240
            .|.|.:..||:........|..|:|.|:.....|.|. ||.|::  |.:.:....||..|.:|.:
Mouse   135 DTEMLLTIPESAQPGTVFPLKAAQDPDMGSNAIQNYT-VSPNLH--FHVVTLSRSDGRKYPELVL 196

  Fly   241 SGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSV 305
            ...||||..|..:|::.|||||.|...|..||:|.|.|:|||.|.|.||.|...||||..:...:
Mouse   197 DRALDREEQPELTLILTALDGGAPRRSGMTTVHIEIMDINDNAPQFVQSLYEVQVPENFPLDALL 261

  Fly   306 LQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGE 370
            :.|.|.|.||...|.:.|::.:...| .|.|.||..||.|.::|.||||....:.:.:.|.|.| 
Mouse   262 VTVSARDLDAGIYGNIAYSLFQGDGD-SQPFVIDEITGEIRLSKKLDFEVTPYYNVEIAATDGG- 324

  Fly   371 QPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNV 435
             .|.....|:::|.|||||.|.:.|..||   || |.|:: |...||...|.||||         
Mouse   325 -GLSGKCTVAVQVLDVNDNAPELTVSTLS---SP-IPENS-PETVVAVFGVFDPDS--------- 374

  Fly   436 TLNGGDGH----------FALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSI 490
               |.:|.          |.|.:...:.|.:....|||||.::.|.:::..:|.|||.|....:|
Mouse   375 ---GDNGRMVCSIQNELPFLLKSTFENYYTLATERPLDRESIAEYNITITVSDMGTPRLTTQHTI 436

  Fly   491 FLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQ 555
            .::::|:|||.|.|.|..|...|.|...|...:..:.|.|.|.|.|:.:||||            
Mouse   437 KVQVSDINDNAPAFTQTSYTLFVHENNSPALHIGTISATDSDSGSNAHITYSL------------ 489

  Fly   556 IDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSV 620
                                            :||                              
Mouse   490 --------------------------------LPP------------------------------ 492

  Fly   621 AENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEF 685
                           .||...::::::              :.:.:|::.....||:|...::||
Mouse   493 ---------------QDPQLALSSLIS--------------INADNGQLFALRALDYEALQAFEF 528

  Fly   686 PVLATDRG--GLSTTAMIKMQLTDVNDNRP-VFYPRE-----YKVSLRESPKASSQASSTPIVAV 742
            .|.|||.|  .||:..::::.:.|.|||.| |.||.:     |...|   |:|:.....  :..|
Mouse   529 HVGATDGGSPALSSQTLVRVVVLDDNDNAPFVLYPLQNASAPYTELL---PRAAEPGYL--VTKV 588

  Fly   743 VATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRS 807
            ||.|.|.|....:|::::...|.|:|.:....||:...|  :||.|..|.|.|.:...|.|....
Mouse   589 VAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTR--LLSERDAPKHRLLLLVKDNGEPLR 651

  Fly   808 NADAVVFLSIIDAMQRP----------PIFEKARYNYYV-------------------------- 836
            :|...:.:.::|...:|          |..|:.....|:                          
Mouse   652 SASVTMHVLVVDGFSQPYLPLPEVALDPTREEDNLTLYLVISLASVSSLFLLSVLLFMGARLCRR 716

  Fly   837 -KE------DIPRGTVVGSVIAASGDVAHRSPVRYSI-YSGD------------------PDGY 874
             :|      .:|.|...|.::..||........:|.: .|||                  ||.|
Mouse   717 AREASLGGYSVPEGHFPGHLVDVSGAGTLSQSYQYEVCLSGDSGITDFKFLKPSNPNSLIPDNY 780

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsNP_001285551.1 CA 111..172 CDD:214520 18/74 (24%)
Cadherin_repeat 178..282 CDD:206637 36/103 (35%)
Cadherin_repeat 291..389 CDD:206637 34/97 (35%)
Cadherin_repeat 406..500 CDD:206637 29/103 (28%)
Cadherin_repeat 509..607 CDD:206637 15/97 (15%)
Cadherin_repeat 616..711 CDD:206637 17/96 (18%)
Cadherin_repeat 719..820 CDD:206637 26/105 (25%)
Cadherin_repeat 832..927 CDD:206637 14/95 (15%)
Cadherin_repeat 937..1032 CDD:206637
Cadherin_repeat 1040..1149 CDD:206637
Cadherin_repeat 1158..1252 CDD:206637
Cadherin_repeat 1263..1361 CDD:206637
Cadherin_repeat 1369..1481 CDD:206637
Cadherin_repeat 1489..1598 CDD:206637
Cadherin_repeat 1614..1710 CDD:206637
Cadherin_repeat 1723..1843 CDD:206637
Cadherin_repeat 1853..1948 CDD:206637
Cadherin_repeat 1957..2053 CDD:206637
Cadherin_repeat 2061..2154 CDD:206637
Cadherin_repeat 2170..2318 CDD:206637
Cadherin_repeat 2326..2424 CDD:206637
Cadherin_repeat 2434..2528 CDD:206637
Cadherin_repeat 2549..2641 CDD:206637
Cadherin_repeat 2652..2748 CDD:206637
Cadherin_repeat 2758..2858 CDD:206637
Cadherin_repeat 2866..2960 CDD:206637
Cadherin_repeat 2985..3071 CDD:206637
Pcdhb4NP_444359.3 Cadherin_2 31..112 CDD:285466 18/90 (20%)
Cadherin_repeat 140..238 CDD:206637 35/100 (35%)
Cadherin_repeat 247..342 CDD:206637 34/97 (35%)
Cadherin_repeat 355..446 CDD:206637 29/103 (28%)
Cadherin_repeat 454..556 CDD:206637 32/204 (16%)
Cadherin_repeat 570..663 CDD:206637 26/99 (26%)
Cadherin_C_2 685..768 CDD:293101 11/82 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I9496
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.