DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ds and Pcdhga6

DIOPT Version :9

Sequence 1:NP_001285551.1 Gene:ds / 33245 FlyBaseID:FBgn0284247 Length:3556 Species:Drosophila melanogaster
Sequence 2:NP_291067.1 Gene:Pcdhga6 / 93714 MGIID:1935218 Length:932 Species:Mus musculus


Alignment Length:1127 Identity:269/1127 - (23%)
Similarity:424/1127 - (37%) Gaps:325/1127 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   932 EASMVRISVPESAELGAPLYAAHAHD-----KDSGSSGQVTYSLVKESGKGLFAIDARSGHLILS 991
            ||..:|.|:||..|.|: ...:.|.|     ::....|   ..::......||:::.|||.|:.:
Mouse    27 EAGQLRYSIPEEVEKGS-FVGSIAKDLGLQPRELAERG---IRIISRGRSQLFSLNQRSGSLVTA 87

  Fly   992 QHLDYES--SQRHTLIVTATDGGVPSLSTNLTI---------LVDVQDVNDNPPVFEKDEYSVNV 1045
            ..:|.|.  :|....:|          |.|:.|         .|::.|:|||.|.|.|:|..:.:
Mouse    88 GRIDREELCAQSAPCLV----------SFNILIEDKLNLYPVEVEIVDINDNAPRFLKEEMELKI 142

  Fly  1046 SESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAP 1110
            .|:.::::..:.:...|.|.|.|:...:::  :|..:.:..:.|.|   |...:|.   :.|...
Mouse   143 LENAALSSHFLLMGVYDPDVGVNSIQGFKL--SGSSHFSVHVQSQD---HGPKYPE---LVLEHS 199

  Fly  1111 LDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVV 1175
            ||||....:.|.::|.|.|.|......|::|.|:|.|||.|.|.:..|...:.|||..|:.|..|
Mouse   200 LDREEEAVHHLVLVAMDGGDPVRTGMARILVTVVDVNDNAPVFTQPIYRVSVPENLPVGTRVLTV 264

  Fly  1176 TASDLDLGENAAIRYSLL----PINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVR 1236
            .|:|.|.|.:|.|.||.:    .|:..|.::|:||||||.|.||.|....|:|.||||||..  .
Mouse   265 NATDQDEGIHAEITYSFVRITEEISQIFCLNPLTGEISTSETLDYEDSRFYELDVEARDQSD--L 327

  Fly  1237 SARVPVRIHVSDVNDNAPEIADPQEDVV-----SVREEQPPGTEVVRVRAVDRDHGQNASITYSI 1296
            ..|..|.|.:.|:||||||:      ||     ::.|..|.||.:...:..|:|..:|..:..||
Mouse   328 QDRAKVLITILDMNDNAPEV------VVTSGSRAIAENSPSGTVIALFQVYDKDSERNGLVICSI 386

  Fly  1297 VKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDN 1361
                                                                             
Mouse   387 ----------------------------------------------------------------- 386

  Fly  1362 RPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAF 1426
                 |.||.|::.|                       |::..|                     
Mouse   387 -----SESLPFKLEE-----------------------SLDNYF--------------------- 402

  Fly  1427 DIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPID 1491
                   .||....||||..|.:.:.:.|.|  ....|.|:.|.:.::|||:|||.|.:.:....
Mouse   403 -------RLVTNTELDREQVSSYNITVTATD--RGTPPLSTKIFISLDVADINDNPPVFSRSSYS 458

  Fly  1492 LQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLF-RMDSLTGALSLQA 1555
            :.|||..|.|..|.:..|.|.|:..|.::.|.|.:     ...|...:|.| .::|:||.|....
Mouse   459 VYVSENNPKGVSIFSLNAVDPDSEENAEIIYSLAK-----ETLQGTPLSSFLSINSITGVLYALC 518

  Fly  1556 PLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSP-NSSGGKTASLFISD 1619
            ..|:|..:|..|:|.|.|:..   ..|.::|::.|.:||.||:.|..:.| ..:.|.|.......
Mouse   519 SFDYEQFRELNLLVTASDRGK---PPLSSNVSLNLFVLDQNDNVPEILYPVLPTDGSTGVELAPR 580

  Fly  1620 ATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRF 1684
            :...|.:|..:||||:|||.|..|:|.:...:..|.|.:...||.|...:.|  ...|..|.   
Mouse   581 SAEPGYLVTKVVAVDKDSGQNAWLSYRLIKASEPGLFSVGLHTGEIRTARVL--LDRDALKQ--- 640

  Fly  1685 NLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPS-----GSFVLQVTAK 1744
            :|::..:||||| |..:::.|.:.|..|                   :|.     ||..|.    
Mouse   641 SLVVAVQDHGQP-PLSATVTLTVAVASS-------------------IPDILADLGSLDLP---- 681

  Fly  1745 SLHGAENANLSYEIPAGVAN---------------DLFHVDWQRGIITTRGQFDRESQASYV--- 1791
              |.:|:::|:..:...||.               .|:|....|.:..||......|.:.:|   
Mouse   682 --HKSEDSSLTIYLVVAVATVSCIFFAFVMGLLVLRLWHWHKSRLLKATRKGVSNMSTSHFVGID 744

  Fly  1792 -LPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGL 1855
             :..:::..:.:.:|::.:    |.|..|....|..|    |:....|             |   
Mouse   745 GVQAFLQTYSHEVSLTADS----RKSHLIFPQPNYAH----TLISQEG-------------C--- 785

  Fly  1856 SVPENSEPGVIHTVVA-----SDLDE--GPNADLIYS------ITGGNLG--------NKF---- 1895
               |.:||.:|....|     ..||:  .||.|..:|      .:|...|        |:|    
Mouse   786 ---EKNEPLLIQEDSAFCKEEDSLDQQAPPNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEM 847

  Fly  1896 -----------SIDSSS---GELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQN 1946
                       :.|.||   |......|......::|||      ..|..||     .:::...|
Mouse   848 LQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQ------HVPDYRQ-----NVYIPGSN 901

  Fly  1947 DNAPRFKLSKYTGSVQEDAPLG 1968
            ..     |:...|.....||.|
Mouse   902 AT-----LTNAAGKRDGKAPAG 918

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsNP_001285551.1 CA 111..172 CDD:214520
Cadherin_repeat 178..282 CDD:206637
Cadherin_repeat 291..389 CDD:206637
Cadherin_repeat 406..500 CDD:206637
Cadherin_repeat 509..607 CDD:206637
Cadherin_repeat 616..711 CDD:206637
Cadherin_repeat 719..820 CDD:206637
Cadherin_repeat 832..927 CDD:206637
Cadherin_repeat 937..1032 CDD:206637 25/110 (23%)
Cadherin_repeat 1040..1149 CDD:206637 26/108 (24%)
Cadherin_repeat 1158..1252 CDD:206637 41/97 (42%)
Cadherin_repeat 1263..1361 CDD:206637 11/102 (11%)
Cadherin_repeat 1369..1481 CDD:206637 22/111 (20%)
Cadherin_repeat 1489..1598 CDD:206637 32/109 (29%)
Cadherin_repeat 1614..1710 CDD:206637 28/95 (29%)
Cadherin_repeat 1723..1843 CDD:206637 24/143 (17%)
Cadherin_repeat 1853..1948 CDD:206637 27/133 (20%)
Cadherin_repeat 1957..2053 CDD:206637 4/12 (33%)
Cadherin_repeat 2061..2154 CDD:206637
Cadherin_repeat 2170..2318 CDD:206637
Cadherin_repeat 2326..2424 CDD:206637
Cadherin_repeat 2434..2528 CDD:206637
Cadherin_repeat 2549..2641 CDD:206637
Cadherin_repeat 2652..2748 CDD:206637
Cadherin_repeat 2758..2858 CDD:206637
Cadherin_repeat 2866..2960 CDD:206637
Cadherin_repeat 2985..3071 CDD:206637
Pcdhga6NP_291067.1 Cadherin_2 30..112 CDD:285466 22/95 (23%)
Cadherin_repeat 137..238 CDD:206637 26/108 (24%)
Cadherin_repeat 246..343 CDD:206637 41/98 (42%)
Cadherin_repeat 356..448 CDD:206637 32/214 (15%)
Cadherin_repeat 463..558 CDD:206637 30/102 (29%)
Cadherin_repeat 579..664 CDD:206637 28/90 (31%)
Cadherin_C_2 688..772 CDD:293101 14/87 (16%)
Cadherin_tail 809..>905 CDD:292596 20/111 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I9496
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.