DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ds and PCDH15

DIOPT Version :10

Sequence 1:NP_523446.2 Gene:ds / 33245 FlyBaseID:FBgn0284247 Length:3556 Species:Drosophila melanogaster
Sequence 2:NP_001136235.1 Gene:PCDH15 / 65217 HGNCID:14674 Length:1962 Species:Homo sapiens


Alignment Length:472 Identity:90/472 - (19%)
Similarity:148/472 - (31%) Gaps:207/472 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 TLSRLVDALATDDGELEST-FV-NVFLNTFRTFAQPEKVLELLLDRYEK------------LHAE 113
            ||:.|...|..|....|.. |: :||         .||.|..|:..:||            ||:.
Human    13 TLALLTSQLRPDSNHREEMGFLRDVF---------SEKSLSYLMKIHEKLRYYERQSPTPVLHSA 68

  Fly   114 PALLQPESLSDQHKKTLVSVLHVWLDGFPEDWDTDNLQRLLAFTSKRLPKSEIHMKA--LNRFTH 176
            .||.:     |..::...:.:|.         |...|.:||         |..|::|  :...|.
Human    69 MALAE-----DVMEELQAASVHS---------DERELLQLL---------STPHLRAVLMVHDTV 110

  Fly   177 RLDKYSRIPPPLPWSNDYHDFADQFGGLCLTPAFRGPPSHLLNSYRFPNIPVKHFAEQLTRMDME 241
            ....:..:.||||.:.|                                   :.|.|:..:: :.
Human   111 AQKNFDPVLPPLPDNID-----------------------------------EDFEEESVKI-VR 139

  Fly   242 LFKRLIPHQCLGAIWSNRDKHECSSVLATVTQFNAVSFRVISSILIEPRLKPQERALLISTWIDI 306
            |.|...|   |||. ..||:|..:.|:|.:.:..|.                 :|:.|    :.:
Human   140 LVKNKEP---LGAT-IRRDEHSGAVVVARIMRGGAA-----------------DRSGL----VHV 179

  Fly   307 AQELRLLKNFSSLKAIISGLQSNAVYRLSKTWAVLPRDKLELYNELARIFSEDNNAWAQREVLMR 371
            ..|||               :.|.:       |||.:..    :|:::|.::...:.        
Human   180 GDELR---------------EVNGI-------AVLHKRP----DEISQILAQSQGSI-------- 210

  Fly   372 EGTAKFADTVGENDRHL-QKVFQKQNTLISHGTIPYLGTFLTDLTMIH------AAIPDTLQDGL 429
              |.|......|.||.. .|||.:                    .:.|      .|||  .|:..
Human   211 --TLKIIPATQEEDRFKDSKVFMR--------------------ALFHYDPREDRAIP--CQEAG 251

  Fly   430 INFDKRRKEFEVLAQIKLLQGAANTYHLPDDPLFDRWFASLLVLD---------------EREAH 479
            :.| :||:..||::|              |||   .|:.:..|.|               .|.::
Human   252 LPF-QRRQVLEVVSQ--------------DDP---TWWQAKRVGDTNLRAGLIPSKQFQERRLSY 298

  Fly   480 TLSCSLEPAPEMTKRPP 496
            ..:....|:|:..|:||
Human   299 RRTTGTLPSPQNFKKPP 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsNP_523446.2 CA 111..172 CDD:214520 12/62 (19%)
Cadherin_repeat 178..282 CDD:206637 19/103 (18%)
Cadherin_repeat 291..389 CDD:206637 16/98 (16%)
Cadherin_repeat 406..500 CDD:206637 23/112 (21%)
Cadherin_repeat 509..607 CDD:206637
Cadherin_repeat 616..711 CDD:206637
Cadherin_repeat 719..820 CDD:206637
Cadherin_repeat 832..927 CDD:206637
Cadherin_repeat 937..1032 CDD:206637
Cadherin_repeat 1040..1149 CDD:206637
Cadherin_repeat 1158..1252 CDD:206637
Cadherin_repeat 1263..1361 CDD:206637
Cadherin_repeat 1369..1481 CDD:206637
Cadherin_repeat 1489..1598 CDD:206637
Cadherin_repeat 1614..1710 CDD:206637
Cadherin_repeat 1723..1843 CDD:206637
Cadherin_repeat 1853..1948 CDD:206637
Cadherin_repeat 1957..2053 CDD:206637
Cadherin_repeat 2061..2154 CDD:206637
CA_like 2171..>2232 CDD:481204
Cadherin_repeat 2326..2424 CDD:206637
Cadherin_repeat 2434..2528 CDD:206637
Cadherin_repeat 2549..2641 CDD:206637
Cadherin_repeat 2652..2748 CDD:206637
Cadherin_repeat 2758..2858 CDD:206637
Cadherin_repeat 2866..2960 CDD:206637
Cadherin_repeat 2985..3071 CDD:206637
PCDH15NP_001136235.1 ECD 36..145 CDD:408229 31/176 (18%)
Cadherin_repeat 156..245 CDD:206637 24/165 (15%)
CA 310..398 CDD:214520 3/6 (50%)
Cadherin_repeat 404..510 CDD:206637
Cadherin_repeat 518..614 CDD:206637
Cadherin_repeat 626..718 CDD:206637
Cadherin_repeat 727..820 CDD:206637
Cadherin_repeat 828..926 CDD:206637
Cadherin_repeat 935..1032 CDD:206637
Cadherin_repeat 1050..1145 CDD:206637
Cadherin_repeat 1154..1248 CDD:206637
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1431..1451
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1608..1630
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1752..1773
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1935..1962
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.