DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ds and PCDHB10

DIOPT Version :9

Sequence 1:NP_001285551.1 Gene:ds / 33245 FlyBaseID:FBgn0284247 Length:3556 Species:Drosophila melanogaster
Sequence 2:NP_061753.1 Gene:PCDHB10 / 56126 HGNCID:8681 Length:800 Species:Homo sapiens


Alignment Length:888 Identity:234/888 - (26%)
Similarity:360/888 - (40%) Gaps:179/888 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   834 YYVKEDIPRGTVVGSVI----AASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHE- 893
            |.|.|:..:|:.|.::.    .|.|::|.|..   .:.|.|...|..:::::||:...:.||.| 
Human    33 YSVTEETEKGSFVVNLAKDLGLAEGELAARGT---RVVSDDNKQYLLLDSHTGNLLTNEKLDREK 94

  Fly   894 ---AKSQVLLNIQATLGEP-PVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAH 954
               .|...:|..|..:.:| .:|   :..:.|.|:||:||.|:.....:.:.|:...|.......
Human    95 LCGPKEPCMLYFQILMDD
PFQIY---RAELRVRDINDHAPVFQDKETVLKISENTAEGTAFRLER 156

  Fly   955 AHDKDSGSSGQVTYSLVKESGKGLFAIDARSG-------HLILSQHLDYESSQRHTLIVTATDGG 1012
            |.|.|.|.:|...|::   |....|.|:...|       .|:|.:.||.|.....:|.:||.|||
Human   157 AQDPDGGLNGIQNYTI---SPNSFFHINISGGDEGMIYPELVLDKALDREEQGELSLTLTALDGG 218

  Fly  1013 VPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVD 1077
            .||.|...|:.:.|.|||||.|.|.:..|.....|:..|...|::|.|.|:|:|.||.::|...|
Human   219 SPSRSGTSTVRIVVLDVNDN
APQFAQALYETQAPENSPIGFLIVKVWAEDVDSGVNAEVSYSFFD 283

  Fly  1078 AGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVR 1142
            |          |.::...|.|.|.||.|:||..||.|..:.|::.:.|.|.|  ...|:.||:|.
Human   284 A----------SENIRTTFQINPFSGEIFLRELLDYELVNSYKINIQAMDGG--GLSARCRVLVE 336

  Fly  1143 VLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAA--------IRYSLLPINSSF 1199
            |||.|||.|:...|.:...:.||... :.:.|...:|.|.|||..        :.:.|.|...:|
Human   337 VLDTNDN
PPELIVSSFSNSVAENSPE-TPLAVFKINDRDSGENGKMVCYIQENLPFLLKPSVENF 400

  Fly  1200 QVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVV 1264
            .:      :.|...||||:|..|::.:...|.|||.......:.:.|||||||||....... .:
Human   401 YI------LITEGALDREIRAEYNITITVTDLGTPRLKTEHNITVLVSDVNDN
APAFTQTSY-TL 458

  Fly  1265 SVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGH----GLFSIDPTSGVIRTRVVLDH 1325
            .|||...|...:..|.|.|||.|.||.:|||::..:|.  |    .|.||:..:|.:.....||:
Human   459 FVRENNSPALHIGSVSATDRDSGTNAQVTYSLLPPQDP--HLPLASLVSINADNGHLFALRSLDY 521

  Fly  1326 EERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRP---------TFTSSSLVFRVREDAALG 1381
            |....:...|.|:|.|:|......::||.|||.|||.|         :...:.||.|..|.   |
Human   522 EALQAFEFRVGATDRGSPALSREALVRVLVLDANDN
SPFVLYPLQNGSAPCTELVPRAAEP---G 583

  Fly  1382 HVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQ 1446
            ::|..:..::          .:|.::..::|.|...|:   ...|.:..|:|.:..||||.....
Human   584 YLVTKVVAVD----------GDSGQNAWLSYQLLKATE---PGLFGVWAHNGEVRTARLLSERDA 635

  Fly  1447 SEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATD 1511
            ::.||.:...|.  ...|:|:..|:.:.:.| ..:.|..|       :.||.|            
Human   636 AKHRLVVLVKDN--GEPPRSATATLHLLLVD
-GFSQPYLP-------LPEAAP------------ 678

  Fly  1512 ADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSS 1576
            |......||                  ::::.:.:|....||           :||.|...    
Human   679 AQAQAEADL------------------LTVYLVVALASVSSL-----------FLLSVLLF---- 710

  Fly  1577 NVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNG 1641
                     |.|||             ...|.........:.:    |....|:|.|......:.
Human   711 ---------VAVRL-------------CRRSRAASVGRCSVPE----GPFPGHLVDVRGAETLSQ 749

  Fly  1642 QLTYEI--TGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGG 1682
            ...||:  |||.|...|            |.|.|...|::..|
Human   750 SYQYEVCLTGGPGTSEF------------KFLKPVISDIQAQG 780

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsNP_001285551.1 CA 111..172 CDD:214520
Cadherin_repeat 178..282 CDD:206637
Cadherin_repeat 291..389 CDD:206637
Cadherin_repeat 406..500 CDD:206637
Cadherin_repeat 509..607 CDD:206637
Cadherin_repeat 616..711 CDD:206637
Cadherin_repeat 719..820 CDD:206637
Cadherin_repeat 832..927 CDD:206637 25/101 (25%)
Cadherin_repeat 937..1032 CDD:206637 31/101 (31%)
Cadherin_repeat 1040..1149 CDD:206637 38/108 (35%)
Cadherin_repeat 1158..1252 CDD:206637 27/101 (27%)
Cadherin_repeat 1263..1361 CDD:206637 35/101 (35%)
Cadherin_repeat 1369..1481 CDD:206637 24/111 (22%)
Cadherin_repeat 1489..1598 CDD:206637 16/108 (15%)
Cadherin_repeat 1614..1710 CDD:206637 16/71 (23%)
Cadherin_repeat 1723..1843 CDD:206637
Cadherin_repeat 1853..1948 CDD:206637
Cadherin_repeat 1957..2053 CDD:206637
Cadherin_repeat 2061..2154 CDD:206637
Cadherin_repeat 2170..2318 CDD:206637
Cadherin_repeat 2326..2424 CDD:206637
Cadherin_repeat 2434..2528 CDD:206637
Cadherin_repeat 2549..2641 CDD:206637
Cadherin_repeat 2652..2748 CDD:206637
Cadherin_repeat 2758..2858 CDD:206637
Cadherin_repeat 2866..2960 CDD:206637
Cadherin_repeat 2985..3071 CDD:206637
PCDHB10NP_061753.1 Cadherin_2 32..112 CDD:285466 20/81 (25%)
Cadherin_repeat 139..238 CDD:206637 31/101 (31%)
Cadherin_repeat 247..343 CDD:206637 38/107 (36%)
Cadherin_repeat 355..447 CDD:206637 27/98 (28%)
Cadherin_repeat 455..557 CDD:206637 35/104 (34%)
Cadherin_repeat 576..664 CDD:206637 22/105 (21%)
Cadherin_C_2 688..770 CDD:293101 23/134 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I9422
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.