DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ds and pcdh1a3

DIOPT Version :9

Sequence 1:NP_001285551.1 Gene:ds / 33245 FlyBaseID:FBgn0284247 Length:3556 Species:Drosophila melanogaster
Sequence 2:NP_001019268.1 Gene:pcdh1a3 / 497126 ZFINID:ZDB-GENE-050202-3 Length:939 Species:Danio rerio


Alignment Length:866 Identity:246/866 - (28%)
Similarity:383/866 - (44%) Gaps:147/866 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 TGEIRTKVKLDRE------TRASYSLVAIPLSGRNI-RVLVTVKDENDNAPTFPQTSMHIEFPEN 186
            ||.:..|.::|||      .:.:.:|.|:..:...: |:.:.:.|.|||||.||:::..:...| 
Zfish    75 TGSLFVKDRIDREELCGVNQKCALNLEALAQN
PHRLYRLEIVIVDVNDNAPFFPESTYPLNVTE- 138

  Fly   187 TPREVKRTLLP-ARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTP 250
            ...|..|..|| |:|||:...:.:.|.:.|   |:.|.|..|.|:. ::..:|.:...||||...
Zfish   139 IANEGDRFPLPFAKDLDVGSNSLKDYKLSS---NEYFSLDVHSEQQ-IVSAELVLQKTLDREKQA 199

  Fly   251 GYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDA 315
            ...|::.|:|||.||..|.:::.:.:.|||||:|||::|.|...|.||:..|..::.:.|||.|.
Zfish   200 VIHLILTAVDGGKPPKSGTLSIIVEVMDVNDN
KPIFSKSLYKVKVKENSQFGAKIITISASDLDE 264

  Fly   316 DENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVS 380
            ..||.::|:. ...:|::.:|.|:..:|.|.:...:|:|.....:|.|.|||.|..|..|...|.
Zfish   265 GTNGQIQYSF-LGNTDEQNLFTINSNSGVIVVQGQIDYEENPAIQLRVQAKDKGSPPKSTHCKVL 328

  Fly   381 IRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNG------ 439
            |.|.|.|||.|.|    ::......:.|.|:||..||.::|.|.|...         ||      
Zfish   329 IEVVDENDN
APEI----VTTPLIESVKEDAKPGTAVALVTVSDKDGGK---------NGIVQCAL 380

  Fly   440 -GDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPE 503
             |...|.|.|..|:.|.::|..|||||.||.|.:::.|.|:|||||.:|..|.:.::|||||.|.
Zfish   381 KGLFPFKLETSYNNHYSLVVDGPLDRESVSQYNITITAADEGTPPLSSSTVITVHVSDVNDNAPH 445

  Fly   504 FEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETH---AQWFQIDPQTGLITT 565
            |...:.:|.:.|.:..|..|.:|.|.|.|.|.|:.|:|||.::..:.   .....|:..:|.|.:
Zfish   446 FPAPVINAFLSENSQAGGLVTKVTADDSDTGENAELSYSLLDSSSSSIPVTTLININSLSGEIFS 510

  Fly   566 RSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNV-SV-AENEP--- 625
            ....:.|.....|..|.|.|.|||||||.|||.|.|.|.|||.|:....:... || .||.|   
Zfish   511 LQSFNHEETKRFQFQVTATDSGVPPLSSNATVNVFILDENDNSPVILAPYSEPGSVNTENIPYSA 575

  Fly   626 -VGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTE------FEVRSASGEICIAGELDFERRSSY 683
             .|..:.|:.:.|.|.|.||:::|       ||||      |.:.|::|||.....:......::
Zfish   576 EAGYFVAKIRSVDADSGYNALLSY-------HLTEPKGTNLFRIGSSTGEIRTKRRMSDNDLKTH 633

  Fly   684 EFPVLATDRGGLS---TTAMIKMQLTDVNDNRPVFYPREYKVSLRESP---KASSQASSTPIVAV 742
            ...:..:|.|..|   ||:|..:.|..::|         .|.|.||.|   ::.|..:...::|:
Zfish   634 PLIITVSDNGEPSLSATTSMDVVVLESLDD---------IKTSFREVPVKEESFSDLNLYLLIAI 689

  Fly   743 VA-------------------TDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFV------VRP 782
            |:                   ||..:..:|.   .::..:..|.:...:||.:..|      ::.
Zfish   690 VSVSVIFLLSLVGLIAAKCYRTDSSFSRYGA---PVINTHPDGSWSFSKSTQQYDVCFSSDTIKS 751

  Fly   783 DMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKA-------RYNYYVKEDI 840
            |:: |...|     ....|...:..|:|     ......|..|..||.       ||:..::..:
Zfish   752 DVV-VFPSP-----FPPADAELISINSD-----DTFTRTQTLPTNEKPKGPNADWRYSASLRAGV 805

  Fly   841 PRGTVVGSVIA----ASGDVAHRSPVRYSIYSGDPDGYFS------IETNSGNIRIAKPLDHEAK 895
            .....:....|    |.|.:....|...|...|:.:|..|      |.:||.:.|          
Zfish   806 QSSVHMEEASAVMQGAQGMLVQNWPTVSSAADGEGEGQLSPPVGAGINSNSWSFR---------- 860

  Fly   896 SQVLLNIQATLGEPPVYGHTQ 916
                      .|..|.||..|
Zfish   861 ----------YGAGPGYGPPQ 871

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsNP_001285551.1 CA 111..172 CDD:214520 13/49 (27%)
Cadherin_repeat 178..282 CDD:206637 32/104 (31%)
Cadherin_repeat 291..389 CDD:206637 32/97 (33%)
Cadherin_repeat 406..500 CDD:206637 38/100 (38%)
Cadherin_repeat 509..607 CDD:206637 36/100 (36%)
Cadherin_repeat 616..711 CDD:206637 29/109 (27%)
Cadherin_repeat 719..820 CDD:206637 21/128 (16%)
Cadherin_repeat 832..927 CDD:206637 18/95 (19%)
Cadherin_repeat 937..1032 CDD:206637
Cadherin_repeat 1040..1149 CDD:206637
Cadherin_repeat 1158..1252 CDD:206637
Cadherin_repeat 1263..1361 CDD:206637
Cadherin_repeat 1369..1481 CDD:206637
Cadherin_repeat 1489..1598 CDD:206637
Cadherin_repeat 1614..1710 CDD:206637
Cadherin_repeat 1723..1843 CDD:206637
Cadherin_repeat 1853..1948 CDD:206637
Cadherin_repeat 1957..2053 CDD:206637
Cadherin_repeat 2061..2154 CDD:206637
Cadherin_repeat 2170..2318 CDD:206637
Cadherin_repeat 2326..2424 CDD:206637
Cadherin_repeat 2434..2528 CDD:206637
Cadherin_repeat 2549..2641 CDD:206637
Cadherin_repeat 2652..2748 CDD:206637
Cadherin_repeat 2758..2858 CDD:206637
Cadherin_repeat 2866..2960 CDD:206637
Cadherin_repeat 2985..3071 CDD:206637
pcdh1a3NP_001019268.1 Cadherin_2 24..106 CDD:285466 8/30 (27%)
Cadherin_repeat 131..231 CDD:206637 32/104 (31%)
Cadherin_repeat 240..337 CDD:206637 32/97 (33%)
Cadherin_repeat 349..442 CDD:206637 38/101 (38%)
Cadherin_repeat 450..552 CDD:206637 36/101 (36%)
Cadherin_repeat 570..658 CDD:206637 25/94 (27%)
Cadherin_C_2 680..752 CDD:293101 9/74 (12%)
Cadherin_tail 788..910 CDD:292596 19/104 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10294
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.