DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ds and PCDHB1

DIOPT Version :10

Sequence 1:NP_523446.2 Gene:ds / 33245 FlyBaseID:FBgn0284247 Length:3556 Species:Drosophila melanogaster
Sequence 2:NP_037472.2 Gene:PCDHB1 / 29930 HGNCID:8680 Length:818 Species:Homo sapiens


Alignment Length:120 Identity:24/120 - (20%)
Similarity:42/120 - (35%) Gaps:39/120 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 LCLTPAFRG------PPSHLLN-----SYRFPNIPVKHFAE----QLTRMDMELFKRLIPHQCLG 253
            :|...|::.      ...|::|     .:|.|...|.||..    .:|.:...|.:.|:..|   
Human    57 ICTREAYQSMKERNVDDGHIININSMCGHRVPPQSVIHFYSATKYAVTALTEGLRQELLEAQ--- 118

  Fly   254 AIWSNRDKHECSSVLATVTQFNAVSFRVISSILIEPR-----------LKPQERA 297
                ...:..|.|.....|||   :|::...   :||           |:|::.|
Human   119 ----THIRATCISPGLVETQF---AFKLYDK---DPREAAATYEHIKCLRPEDVA 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsNP_523446.2 CA 111..172 CDD:214520
Cadherin_repeat 178..282 CDD:206637 19/92 (21%)
Cadherin_repeat 291..389 CDD:206637 3/7 (43%)
Cadherin_repeat 406..500 CDD:206637
Cadherin_repeat 509..607 CDD:206637
Cadherin_repeat 616..711 CDD:206637
Cadherin_repeat 719..820 CDD:206637
Cadherin_repeat 832..927 CDD:206637
Cadherin_repeat 937..1032 CDD:206637
Cadherin_repeat 1040..1149 CDD:206637
Cadherin_repeat 1158..1252 CDD:206637
Cadherin_repeat 1263..1361 CDD:206637
Cadherin_repeat 1369..1481 CDD:206637
Cadherin_repeat 1489..1598 CDD:206637
Cadherin_repeat 1614..1710 CDD:206637
Cadherin_repeat 1723..1843 CDD:206637
Cadherin_repeat 1853..1948 CDD:206637
Cadherin_repeat 1957..2053 CDD:206637
Cadherin_repeat 2061..2154 CDD:206637
CA_like 2171..>2232 CDD:481204
Cadherin_repeat 2326..2424 CDD:206637
Cadherin_repeat 2434..2528 CDD:206637
Cadherin_repeat 2549..2641 CDD:206637
Cadherin_repeat 2652..2748 CDD:206637
Cadherin_repeat 2758..2858 CDD:206637
Cadherin_repeat 2866..2960 CDD:206637
Cadherin_repeat 2985..3071 CDD:206637
PCDHB1NP_037472.2 Cadherin_2 30..110 CDD:462413 10/52 (19%)
Cadherin_repeat 140..238 CDD:206637 5/27 (19%)
Cadherin_repeat 246..343 CDD:206637
Cadherin_repeat 356..448 CDD:206637
Cadherin_repeat 456..558 CDD:206637
Cadherin_repeat 577..665 CDD:206637
Cadherin_C_2 688..772 CDD:465139
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 789..818
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.