DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ds and Fat3

DIOPT Version :10

Sequence 1:NP_523446.2 Gene:ds / 33245 FlyBaseID:FBgn0284247 Length:3556 Species:Drosophila melanogaster
Sequence 2:XP_011240845.1 Gene:Fat3 / 270120 MGIID:2444314 Length:4611 Species:Mus musculus


Alignment Length:330 Identity:66/330 - (20%)
Similarity:114/330 - (34%) Gaps:96/330 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 LKPQERALLIS------TWIDIAQELRLLKNFSSLK-AIISGLQSNAVYRLSKTWAVLPRDKLEL 348
            ||...|||:.|      :|.. .:..:|.:|::..: .::.|:..:..| |..|....|:     
Mouse     4 LKSAGRALIRSPSLAKQSWAG-GRHRKLPENWTDTRETLLEGMVFSLKY-LGMTLVERPK----- 61

  Fly   349 YNELARIFSEDNNAWAQREVLMREGTAKFADTVGENDRHLQKVFQKQNTLISHGTIPYLGTFLTD 413
                    .|:.:|.|.:.::   .|||      .:.:.||||..|         :...|..|||
Mouse    62 --------GEELSAAAVKRIV---ATAK------ASGKKLQKVTLK---------VSPRGIILTD 100

  Fly   414 -----------LTMIHAAIPDTLQDGLINFDKRRKEFEVL-------AQIKLLQGAANTYHLPDD 460
                       :..|.....|.:.|.:..:..:.::.|.|       .:.|:.|....|......
Mouse   101 SLTSQLIENVSIYRISYCTADKMHDKVFAYIAQSQQNESLECHAFLCTKRKVAQAVTLTVAQAFK 165

  Fly   461 PLFDRWFASLLVLDEREAHTLSCSLEPAPEMTKRPPAPPAQHPGGGIGGGGGGTPGHKKSDSIAS 525
            ..|:.|..|   .:|:|               ||..|          ...||..||.::..:.:.
Mouse   166 VAFEFWQVS---KEEKE---------------KREKA----------NQEGGDVPGTRRDSTPSL 202

  Fly   526 NSSSGAGSQFYCDINSTSNA---SYSSRNNSLDRDATPPNASILSAASSVSSL--SMDSTTSGSQ 585
            .:|...|:  ..|:...:.|   :.|:...::| ||..|  .:|...|.|..|  .:|...|...
Mouse   203 KTSVATGN--LLDLEELAKAPLSTVSANTKNMD-DALRP--QVLGNNSVVWELDDGLDEAFSRLA 262

  Fly   586 RSNHN 590
            :|..|
Mouse   263 QSRTN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsNP_523446.2 CA 111..172 CDD:214520
Cadherin_repeat 178..282 CDD:206637
Cadherin_repeat 291..389 CDD:206637 20/104 (19%)
Cadherin_repeat 406..500 CDD:206637 20/111 (18%)
Cadherin_repeat 509..607 CDD:206637 21/87 (24%)
Cadherin_repeat 616..711 CDD:206637
Cadherin_repeat 719..820 CDD:206637
Cadherin_repeat 832..927 CDD:206637
Cadherin_repeat 937..1032 CDD:206637
Cadherin_repeat 1040..1149 CDD:206637
Cadherin_repeat 1158..1252 CDD:206637
Cadherin_repeat 1263..1361 CDD:206637
Cadherin_repeat 1369..1481 CDD:206637
Cadherin_repeat 1489..1598 CDD:206637
Cadherin_repeat 1614..1710 CDD:206637
Cadherin_repeat 1723..1843 CDD:206637
Cadherin_repeat 1853..1948 CDD:206637
Cadherin_repeat 1957..2053 CDD:206637
Cadherin_repeat 2061..2154 CDD:206637
CA_like 2171..>2232 CDD:481204
Cadherin_repeat 2326..2424 CDD:206637
Cadherin_repeat 2434..2528 CDD:206637
Cadherin_repeat 2549..2641 CDD:206637
Cadherin_repeat 2652..2748 CDD:206637
Cadherin_repeat 2758..2858 CDD:206637
Cadherin_repeat 2866..2960 CDD:206637
Cadherin_repeat 2985..3071 CDD:206637
Fat3XP_011240845.1 Cadherin_repeat 47..153 CDD:206637 25/137 (18%)
Cadherin_repeat 162..262 CDD:206637 27/132 (20%)
CA 286..373 CDD:214520
Cadherin_repeat 380..468 CDD:206637
Cadherin_repeat 477..574 CDD:206637
Cadherin_repeat 592..672 CDD:206637
Cadherin_repeat 733..827 CDD:206637
Cadherin_repeat 835..931 CDD:206637
Cadherin_repeat 940..1018 CDD:206637
Cadherin_repeat 1049..1144 CDD:206637
Cadherin_repeat 1152..1250 CDD:206637
Cadherin_repeat 1258..1348 CDD:206637
Cadherin_repeat 1367..1479 CDD:206637
Cadherin_repeat 1487..1585 CDD:206637
Cadherin_repeat 1594..1684 CDD:206637
Cadherin_repeat 1699..1788 CDD:206637
Cadherin_repeat 1796..1902 CDD:206637
Cadherin_repeat 1921..2000 CDD:206637
Cadherin_repeat 2010..2103 CDD:206637
Cadherin_repeat 2111..2202 CDD:206637
Cadherin_repeat 2214..2306 CDD:206637
Cadherin_repeat 2314..2413 CDD:206637
Cadherin_repeat 2421..2513 CDD:206637
Cadherin_repeat 2523..2619 CDD:206637
Cadherin_repeat 2627..2722 CDD:206637
Cadherin_repeat 2735..2833 CDD:206637
Cadherin_repeat 2841..2943 CDD:206637
Cadherin_repeat 2951..3048 CDD:206637
Cadherin_repeat 3057..3150 CDD:206637
Cadherin_repeat 3158..3255 CDD:206637
Cadherin_repeat 3264..3360 CDD:206637
Cadherin_repeat 3368..3465 CDD:206637
Cadherin_repeat 3474..3565 CDD:206637
Cadherin_repeat 3584..3661 CDD:206637
Laminin_G_2 3888..4016 CDD:460494
EGF_CA 4046..4081 CDD:238011
EGF_CA 4080..4119 CDD:238011
EGF_CA 4121..4156 CDD:238011
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.