DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ds and CDHR3

DIOPT Version :9

Sequence 1:NP_001285551.1 Gene:ds / 33245 FlyBaseID:FBgn0284247 Length:3556 Species:Drosophila melanogaster
Sequence 2:NP_689963.2 Gene:CDHR3 / 222256 HGNCID:26308 Length:885 Species:Homo sapiens


Alignment Length:632 Identity:167/632 - (26%)
Similarity:283/632 - (44%) Gaps:73/632 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   619 SVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKH------LTE-FEVRSASG---EICIAG 673
            :||||.|.|..:.|.|..     ::|.::..| .||..      ||| |.|...||   |:...|
Human    30 NVAENSPPGTSVHKFSVK-----LSASLSPVI-PGFPQIVNSNPLTEAFRVNWLSGTYFEVVTTG 88

  Fly   674 --ELDFERRSS-YEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQAS 735
              :||||...: ::..:...|..|::...::.:|:||||:      |.:::.:|.|.........
Human    89 MEQLDFETGPNIFDLQIYVKDEVGVTDLQVLTVQVTDVNE
------PPQFQGNLAEGLHLYIVER 147

  Fly   736 STP--IVAVVATDP-DYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNI 797
            :.|  |..|.|.|| |......:||.:::..::  ||:. :.|.:|...........:..|:: :
Human   148 ANPGFIYQVEAFDPEDTSRNIPLSYFLISPPKS--FRMS-ANGTLFSTTELDFEAGHRSFHLI-V 208

  Fly   798 SATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAAS-GDVAHRSP 861
            ...|.|.|:::.:..|  :|::.....|.|......|.|.|::..||:|.::.|.. .|....|.
Human   209 EVRDSGGLKASTELQV--NIVNLND
EVPRFTSPTRVYTVLEELSPGTIVANITAEDPDDEGFPSH 271

  Fly   862 VRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEA---KSQVLLNIQATLGEPPVYG----HTQVNI 919
            :.|||.:  ...||.|...:|.|::|:.:|.:|   :....::::..:.:.| ||    ..|:..
Human   272 LLYSITT--VSKYFMINQLTGTIQVAQRIDRDAGELRQNPTISLEVLVKDRP-YGGQENRIQITF 333

  Fly   920 EVEDVNDNAPEFEASMVRISVPESAELGAPLYAAH--AHDKDS-GSSGQVTYSLVKESGKG-LFA 980
            .|||||||....:.....|.|||....|..|...:  ..|.|| ..:.:..:::....|.| .|.
Human   334 IVEDVNDN
PATCQKFTFSIMVPERTAKGTLLLDLNKFCFDDDSEAPNNRFNFTMPSGVGSGSRFL 398

  Fly   981 ID-ARSGHLILSQHLDYE------SSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEK 1038
            .| |.||.::|...||||      :..::|:|:...|...|....|:.:.:.....|:.|.:|::
Human   399 QDPAGSGKIVLIGDLDYENPSNLAAGNKYTVIIQVQDVAPPYYKNNVYVYILTSPENEFPLIFDR 463

  Fly  1039 DEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSG 1103
            ..|..:|||.|....::.||.|:|.|...:: :.|.|...|.     |:...:|   |.|.|.:|
Human   464 PSYVFDVSERRPARTRVGQVRATDKDLPQSS-LLYSISTGGA-----SLQYPNV---FWINPKTG 519

  Fly  1104 WIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRR 1168
            .:.|...:|.||...|.|.:.||:|...::   ..|.|.:|:.||..|....:.|...:..:|:.
Human   520 ELQLVTKVDCETTPIYILRIQATNNEDTSS---VTVTVNILEENDEKPICTPNSYFLALPVDLKV 581

  Fly  1169 GSVVG--VVTASDLDLGENAAIRYSLLP--INSSFQVHPVTGEISTR 1211
            |:.:.  .:|.:||| ....:.|||:.|  :|:.|...|..|...||
Human   582 GTNIQNFKLTCTDLD-SSPRSFRYSIGPGNVNNHFTFSPNAGSNVTR 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsNP_001285551.1 CA 111..172 CDD:214520
Cadherin_repeat 178..282 CDD:206637
Cadherin_repeat 291..389 CDD:206637
Cadherin_repeat 406..500 CDD:206637
Cadherin_repeat 509..607 CDD:206637
Cadherin_repeat 616..711 CDD:206637 32/104 (31%)
Cadherin_repeat 719..820 CDD:206637 21/103 (20%)
Cadherin_repeat 832..927 CDD:206637 29/102 (28%)
Cadherin_repeat 937..1032 CDD:206637 27/105 (26%)
Cadherin_repeat 1040..1149 CDD:206637 32/108 (30%)
Cadherin_repeat 1158..1252 CDD:206637 17/58 (29%)
Cadherin_repeat 1263..1361 CDD:206637
Cadherin_repeat 1369..1481 CDD:206637
Cadherin_repeat 1489..1598 CDD:206637
Cadherin_repeat 1614..1710 CDD:206637
Cadherin_repeat 1723..1843 CDD:206637
Cadherin_repeat 1853..1948 CDD:206637
Cadherin_repeat 1957..2053 CDD:206637
Cadherin_repeat 2061..2154 CDD:206637
Cadherin_repeat 2170..2318 CDD:206637
Cadherin_repeat 2326..2424 CDD:206637
Cadherin_repeat 2434..2528 CDD:206637
Cadherin_repeat 2549..2641 CDD:206637
Cadherin_repeat 2652..2748 CDD:206637
Cadherin_repeat 2758..2858 CDD:206637
Cadherin_repeat 2866..2960 CDD:206637
Cadherin_repeat 2985..3071 CDD:206637
CDHR3NP_689963.2 Cadherin_repeat 26..128 CDD:206637 31/103 (30%)
Cadherin_repeat 141..231 CDD:206637 19/95 (20%)
Cadherin_repeat 242..341 CDD:206637 29/101 (29%)
Cadherin_repeat 349..456 CDD:206637 26/106 (25%)
Cadherin_repeat 465..561 CDD:206637 31/107 (29%)
Cadherin_repeat 570..679 CDD:206637 17/59 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 808..885
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.