DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ds and AgaP_AGAP009722

DIOPT Version :9

Sequence 1:	NP_001285551.1	Gene:	ds / 33245	FlyBaseID:	FBgn0284247	Length:	3556	Species:	Drosophila melanogaster
Sequence 2:	XP_318797.3	Gene:	AgaP_AGAP009722 / 1279126	VectorBaseID:	AGAP009722	Length:	125	Species:	Anopheles gambiae

Alignment Length:	125	Identity:	39/125 - (31%)
Similarity:	57/125 - (45%)	Gaps:	15/125 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly   523 VLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTR-SHIDCETEPVPQLTVVARDG 586
            |:.:.|.|.|: :|.......|...:|....|.::|.||||||. ..:|.|..|...|.:|..||
Mosquito     3 VMTINAKDYDD-INEGTNAKNAIEEDTDLPIFDVNPDTGLITTAVCCLDREKTPDYSLQIVTIDG 66

  Fly   587 GVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENE-------PVGRCILKVSASDPD 639
              ..|..|.|..:.:.|:||..|.|.:..:.|.|.|::       |    ||.|:.:|.|
Mosquito    67 --VGLKGTGTASIKVKDLNDMPPQFTKDEWFVEVEESDGSVLSEAP----ILTVAMNDDD 120

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ds	NP_001285551.1	CA	111..172	CDD:214520
		Cadherin_repeat	178..282	CDD:206637
		Cadherin_repeat	291..389	CDD:206637
		Cadherin_repeat	406..500	CDD:206637
		Cadherin_repeat	509..607	CDD:206637	27/84 (32%)
		Cadherin_repeat	616..711	CDD:206637	9/31 (29%)
		Cadherin_repeat	719..820	CDD:206637
		Cadherin_repeat	832..927	CDD:206637
		Cadherin_repeat	937..1032	CDD:206637
		Cadherin_repeat	1040..1149	CDD:206637
		Cadherin_repeat	1158..1252	CDD:206637
		Cadherin_repeat	1263..1361	CDD:206637
		Cadherin_repeat	1369..1481	CDD:206637
		Cadherin_repeat	1489..1598	CDD:206637
		Cadherin_repeat	1614..1710	CDD:206637
		Cadherin_repeat	1723..1843	CDD:206637
		Cadherin_repeat	1853..1948	CDD:206637
		Cadherin_repeat	1957..2053	CDD:206637
		Cadherin_repeat	2061..2154	CDD:206637
		Cadherin_repeat	2170..2318	CDD:206637
		Cadherin_repeat	2326..2424	CDD:206637
		Cadherin_repeat	2434..2528	CDD:206637
		Cadherin_repeat	2549..2641	CDD:206637
		Cadherin_repeat	2652..2748	CDD:206637
		Cadherin_repeat	2758..2858	CDD:206637
		Cadherin_repeat	2866..2960	CDD:206637
		Cadherin_repeat	2985..3071	CDD:206637
AgaP_AGAP009722	XP_318797.3	Cadherin_repeat	3..84	CDD:206637	26/83 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E33208_3B9B2
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900