DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ds and AgaP_AGAP009722

DIOPT Version :9

Sequence 1:NP_001285551.1 Gene:ds / 33245 FlyBaseID:FBgn0284247 Length:3556 Species:Drosophila melanogaster
Sequence 2:XP_318797.3 Gene:AgaP_AGAP009722 / 1279126 VectorBaseID:AGAP009722 Length:125 Species:Anopheles gambiae


Alignment Length:125 Identity:39/125 - (31%)
Similarity:57/125 - (45%) Gaps:15/125 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   523 VLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTR-SHIDCETEPVPQLTVVARDG 586
            |:.:.|.|.|: :|.......|...:|....|.::|.||||||. ..:|.|..|...|.:|..||
Mosquito     3 VMTINAKDYDD-INEGTNAKNAIEEDTDLPIFDVNPDTGLITTAVCCLDREKTPDYSLQIVTIDG 66

  Fly   587 GVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENE-------PVGRCILKVSASDPD 639
              ..|..|.|..:.:.|:||..|.|.:..:.|.|.|::       |    ||.|:.:|.|
Mosquito    67 --VGLKGTGTASIKVKDLNDMPPQFTKDEWFVEVEESDGSVLSEAP----ILTVAMNDDD 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsNP_001285551.1 CA 111..172 CDD:214520
Cadherin_repeat 178..282 CDD:206637
Cadherin_repeat 291..389 CDD:206637
Cadherin_repeat 406..500 CDD:206637
Cadherin_repeat 509..607 CDD:206637 27/84 (32%)
Cadherin_repeat 616..711 CDD:206637 9/31 (29%)
Cadherin_repeat 719..820 CDD:206637
Cadherin_repeat 832..927 CDD:206637
Cadherin_repeat 937..1032 CDD:206637
Cadherin_repeat 1040..1149 CDD:206637
Cadherin_repeat 1158..1252 CDD:206637
Cadherin_repeat 1263..1361 CDD:206637
Cadherin_repeat 1369..1481 CDD:206637
Cadherin_repeat 1489..1598 CDD:206637
Cadherin_repeat 1614..1710 CDD:206637
Cadherin_repeat 1723..1843 CDD:206637
Cadherin_repeat 1853..1948 CDD:206637
Cadherin_repeat 1957..2053 CDD:206637
Cadherin_repeat 2061..2154 CDD:206637
Cadherin_repeat 2170..2318 CDD:206637
Cadherin_repeat 2326..2424 CDD:206637
Cadherin_repeat 2434..2528 CDD:206637
Cadherin_repeat 2549..2641 CDD:206637
Cadherin_repeat 2652..2748 CDD:206637
Cadherin_repeat 2758..2858 CDD:206637
Cadherin_repeat 2866..2960 CDD:206637
Cadherin_repeat 2985..3071 CDD:206637
AgaP_AGAP009722XP_318797.3 Cadherin_repeat 3..84 CDD:206637 26/83 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9B2
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.