DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ds and si:ch73-379j16.2

DIOPT Version :9

Sequence 1:NP_001285551.1 Gene:ds / 33245 FlyBaseID:FBgn0284247 Length:3556 Species:Drosophila melanogaster
Sequence 2:XP_017214536.1 Gene:si:ch73-379j16.2 / 108179154 ZFINID:ZDB-GENE-141215-68 Length:791 Species:Danio rerio


Alignment Length:857 Identity:234/857 - (27%)
Similarity:378/857 - (44%) Gaps:147/857 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   830 ARYNYYVKEDIPRGTVVGSVIAASG-DVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHE 893
            |:..|.:.|::..||:||::....| ||:.....|:.|.||..|..|.:..|:|.:.:.|.:|.|
Zfish    31 AQIRYSIPEEVKEGTIVGNIAKDLGLDVSTLLDRRFRIVSGSNDALFQVNQNNGMLYVGKLIDRE 95

  Fly   894 A----KSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAH 954
            |    .:..|:::: |:.|.|:..| .|.:|:.||||:||.|....|.:.:.||...|.......
Zfish    96 ALCDGNTACLISLK-TVVENPLEIH-YVEVEITDVNDHAPSFANKDVLLEIQESTIPGEDFQLQE 158

  Fly   955 AHDKDSGSSGQVTYSLVKESGKGLFAIDARSGH-------LILSQHLDYESSQRHTLIVTATDGG 1012
            |:|.|||.:....|.|   |....|.|:.|...       |.|.:.||.|....|:|||||.|||
Zfish   159 AYDPDSGVNSVRFYKL---SQTEYFEIELRENGGEKKVPVLKLRKSLDRERQVIHSLIVTAVDGG 220

  Fly  1013 VPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVD 1077
            ....|.:..|.|.|.|.|||.|.|.::.|||::.|:..:...:|::||:|||.|.|..|.|..  
Zfish   221 NQPRSGSTVINVTVLDDNDNRPKFSQELYSVSLRENAPLGTLVIKLNATDLDEGQNGEIVYSF-- 283

  Fly  1078 AGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVR 1142
              |.|:...|..:     |.: .|:|.|.::..||.|..:.|::.|:|:|.|.|...:..|:|::
Zfish   284 --VKNIEKYIYDT-----FDL-DNTGEIRVKGSLDFEKNNVYRIAVMASDKGQPPKTSNCRIIIK 340

  Fly  1143 VLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAA--------IRYSLLPINSSF 1199
            |:|.|||.|:.:.:.....:.|:.:.|:|:.:|:.:|.|.|.|..        :.:.|.|   ||
Zfish   341 VIDENDNAPEIEVTSLSDVVPEDSKPGAVISLVSITDKDSGVNGKVVCRISDDVPFELKP---SF 402

  Fly  1200 QVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPE-IADPQEDV 1263
            :.:..:  :.|...|||||...||:.:.|.|.|.|..|:...:::.:||||||||| :.:|.|  
Zfish   403 KDNMYS--LVTNAKLDRELTSHYDVTITATDLGQPPLSSIKTLKVQISDVNDNAPEFVHNPLE-- 463

  Fly  1264 VSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGH--GLFSIDPTSGVIRTRVVLDHE 1326
            :.:.|...||..:..|.|.|||..:||:|||.|::...:..|  ...:::..:|.|......|.|
Zfish   464 LYLMENNAPGASIYSVSAFDRDLNENAAITYQIIREEGTRSHMSSFLNVNADNGHIHALKSFDFE 528

  Fly  1327 ERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFT-------SSSLVFRVREDAALGHVV 1384
            ....::..:.|:|.|:|...:...:.|.:||.|||.|...       |:..|..:..:...||:|
Zfish   529 SVKTFQFHILATDSGSPSLSSNVTVNVFILDQNDNVPVILYPVSANGSAEGVEEIPRNVNAGHLV 593

  Fly  1385 GSISPIERPADVVRN-----SVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDRE 1444
            ..:...:  ||:..|     |::|..|                .:.|.:||::|.:...|.....
Zfish   594 TKVRAYD--ADIGYNGWLLFSLQEVSE----------------HSLFALDRYTGQIRTLRSFTET 640

  Fly  1445 VQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTA 1509
            .:::.:|.|...|.  .|...|:..||.::|.:        |::.                 |.|
Zfish   641 DEAQHKLVILVKDN--GNVSLSATATVIVKVVE--------PKEA-----------------FAA 678

  Fly  1510 TDA-----DTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIV 1569
            :|.     |...|....|.:|..         .::|:..:.|:...:.:|.....:...:||   
Zfish   679 SDVKNAEKDEEENNVTFYLIIPL---------GSVSVLFVISIIVLIVMQCSKSTDYSSKYL--- 731

  Fly  1570 QALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTA-------SLFISDATRIGEVV 1627
                |.:|....|..|:..|     :.|.....|.|..|.|.|.       :|.|.|..|     
Zfish   732 ----QDTNYDGTLCHSIQYR-----SGDKRYMLVGPRMSIGSTIAPGSNRNTLVIPDRRR----- 782

  Fly  1628 AHIVAVDEDSGD 1639
                   .|||:
Zfish   783 -------RDSGE 787

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsNP_001285551.1 CA 111..172 CDD:214520
Cadherin_repeat 178..282 CDD:206637
Cadherin_repeat 291..389 CDD:206637
Cadherin_repeat 406..500 CDD:206637
Cadherin_repeat 509..607 CDD:206637
Cadherin_repeat 616..711 CDD:206637
Cadherin_repeat 719..820 CDD:206637
Cadherin_repeat 832..927 CDD:206637 31/99 (31%)
Cadherin_repeat 937..1032 CDD:206637 34/101 (34%)
Cadherin_repeat 1040..1149 CDD:206637 35/108 (32%)
Cadherin_repeat 1158..1252 CDD:206637 29/101 (29%)
Cadherin_repeat 1263..1361 CDD:206637 27/99 (27%)
Cadherin_repeat 1369..1481 CDD:206637 23/116 (20%)
Cadherin_repeat 1489..1598 CDD:206637 17/113 (15%)
Cadherin_repeat 1614..1710 CDD:206637 7/26 (27%)
Cadherin_repeat 1723..1843 CDD:206637
Cadherin_repeat 1853..1948 CDD:206637
Cadherin_repeat 1957..2053 CDD:206637
Cadherin_repeat 2061..2154 CDD:206637
Cadherin_repeat 2170..2318 CDD:206637
Cadherin_repeat 2326..2424 CDD:206637
Cadherin_repeat 2434..2528 CDD:206637
Cadherin_repeat 2549..2641 CDD:206637
Cadherin_repeat 2652..2748 CDD:206637
Cadherin_repeat 2758..2858 CDD:206637
Cadherin_repeat 2866..2960 CDD:206637
Cadherin_repeat 2985..3071 CDD:206637
si:ch73-379j16.2XP_017214536.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I9353
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.