powered by:
Protein Alignment ds and avpr1b
DIOPT Version :9
Sequence 1: | NP_001285551.1 |
Gene: | ds / 33245 |
FlyBaseID: | FBgn0284247 |
Length: | 3556 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017947031.1 |
Gene: | avpr1b / 100487856 |
XenbaseID: | XB-GENE-481094 |
Length: | 392 |
Species: | Xenopus tropicalis |
Alignment Length: | 59 |
Identity: | 16/59 - (27%) |
Similarity: | 23/59 - (38%) |
Gaps: | 20/59 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 2225 NKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNS--TRSQRALTSSSFALT 2281
|..:|||| ||....||:| .||.|. .:::.||..:...:|
Frog 3 NNSYLLDY---------ALKLPSALNY---------TDPRNEDLAKAEVALLGAILVIT 43
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
68 |
1.000 |
Domainoid score |
I9561 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.