DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ds and avpr1b

DIOPT Version :9

Sequence 1:	NP_001285551.1	Gene:	ds / 33245	FlyBaseID:	FBgn0284247	Length:	3556	Species:	Drosophila melanogaster
Sequence 2:	XP_017947031.1	Gene:	avpr1b / 100487856	XenbaseID:	XB-GENE-481094	Length:	392	Species:	Xenopus tropicalis

Alignment Length:	59	Identity:	16/59 - (27%)
Similarity:	23/59 - (38%)	Gaps:	20/59 - (33%)

- Green bases have known domain annotations that are detailed below.

  Fly  2225 NKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNS--TRSQRALTSSSFALT 2281
            |..:||||         ||....||:|         .||.|.  .:::.||..:...:|
Frog     3 NNSYLLDY---------ALKLPSALNY---------TDPRNEDLAKAEVALLGAILVIT 43

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ds	NP_001285551.1	CA	111..172	CDD:214520
		Cadherin_repeat	178..282	CDD:206637
		Cadherin_repeat	291..389	CDD:206637
		Cadherin_repeat	406..500	CDD:206637
		Cadherin_repeat	509..607	CDD:206637
		Cadherin_repeat	616..711	CDD:206637
		Cadherin_repeat	719..820	CDD:206637
		Cadherin_repeat	832..927	CDD:206637
		Cadherin_repeat	937..1032	CDD:206637
		Cadherin_repeat	1040..1149	CDD:206637
		Cadherin_repeat	1158..1252	CDD:206637
		Cadherin_repeat	1263..1361	CDD:206637
		Cadherin_repeat	1369..1481	CDD:206637
		Cadherin_repeat	1489..1598	CDD:206637
		Cadherin_repeat	1614..1710	CDD:206637
		Cadherin_repeat	1723..1843	CDD:206637
		Cadherin_repeat	1853..1948	CDD:206637
		Cadherin_repeat	1957..2053	CDD:206637
		Cadherin_repeat	2061..2154	CDD:206637
		Cadherin_repeat	2170..2318	CDD:206637	16/59 (27%)
		Cadherin_repeat	2326..2424	CDD:206637
		Cadherin_repeat	2434..2528	CDD:206637
		Cadherin_repeat	2549..2641	CDD:206637
		Cadherin_repeat	2652..2748	CDD:206637
		Cadherin_repeat	2758..2858	CDD:206637
		Cadherin_repeat	2866..2960	CDD:206637
		Cadherin_repeat	2985..3071	CDD:206637
avpr1b	XP_017947031.1	None
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	68	1.000	Domainoid score	I9561
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	2	2.000