DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and MRC2

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_006030.2 Gene:MRC2 / 9902 HGNCID:16875 Length:1479 Species:Homo sapiens


Alignment Length:298 Identity:67/298 - (22%)
Similarity:113/298 - (37%) Gaps:57/298 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CNVFAENDILQDPLIS-------SYDRLKKLGEMCLIDILPILENISEQQ-----KEGYTANFRI 70
            |..|.:.|.|.|....       |:.......|....|:|.|.| |.||.     ..||::...|
Human   235 CETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITE-IHEQTYINGLLTGYSSTLWI 298

  Fly    71 -FNETQGILDRIEGHQEVNDKQLK------------------ALKVKMEGHFMDLHAKMEIKVKK 116
             .|:    ||...|.|..::..||                  .::.:..|.:.:...       .
Human   299 GLND----LDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDC-------S 352

  Fly   117 LSLEKSLRKALNA-LQCSLDTRNVSSKVSLHPEFEKVGSRFFYIERHVKQNWFDAMTKCREMGGH 180
            ::|....:|..|| .:.:...|..:.||...|.::......:.::.. |::|.::...|...||.
Human   353 IALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQAE-KRSWQESKKACLRGGGD 416

  Fly   181 LASPQNEEELHLISQ--KLDTESYWLDLSDLTDHGQYISLVSGSKAPFLKWNKGQPN--RENAQ- 240
            |.|..:..||..|::  |.:.|..|:.|:||.....: ....||...|..|:..:||  |::.: 
Human   417 LVSIHSMAELEFITKQIKQEVEELWIGLNDLKLQMNF-EWSDGSLVSFTHWHPFEPNNFRDSLED 480

  Fly   241 CVRVKG--GLYQTFQCDHRVLFIC----QANQNRKKED 272
            ||.:.|  |.:....|:..:..||    |.:|...:||
Human   481 CVTIWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEED 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 31/126 (25%)
MRC2NP_006030.2 RICIN 43..>127 CDD:238092
RICIN 46..161 CDD:214672
FN2 180..228 CDD:128373
CLECT 247..361 CDD:153057 21/125 (17%)
CLECT 382..505 CDD:214480 30/124 (24%)
CLECT 521..644 CDD:214480
CLECT 669..809 CDD:214480
CLECT 829..951 CDD:214480
CLECT 972..1108 CDD:214480
CLECT 1137..1245 CDD:153057
CLECT 1261..1394 CDD:214480
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1450..1479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.