DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and CLEC11A

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_002966.1 Gene:CLEC11A / 6320 HGNCID:10576 Length:323 Species:Homo sapiens


Alignment Length:229 Identity:49/229 - (21%)
Similarity:83/229 - (36%) Gaps:61/229 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 ILDRIEGHQEVNDKQLKALKVKMEGHFMDLHAKMEIKVKKLSLEKSLRKALNALQCSLDTRNVSS 141
            ||.|:.|    .|..|..|.|:       |||   :..:.:.|.:.||:..||   :.|||:...
Human   111 ILGRLAG----LDAGLHQLHVR-------LHA---LDTRVVELTQGLRQLRNA---AGDTRDAVQ 158

  Fly   142 KVS--------LHPEFE------KVGSRFFYIERHVKQNWFDAMTKCREMGGHLASPQNEEELHL 192
            .:.        .|...|      ::|.:.|.:.|..:.. ..|..:|...||.||.|.:.:::..
Human   159 ALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRDFEAQ-AAAQARCTARGGSLAQPADRQQMEA 222

  Fly   193 ISQKLDTE------SYWLDLSDLTDHGQYISLVSGSKAPFLKWNKG------------------- 232
            :::.|...      ..||.:.|....|.|: ..:|.:..|..|::.                   
Human   223 LTRYLRAALAPYNWPVWLGVHDRRAEGLYL-FENGQRVSFFAWHRSPRPELGAQPSASPHPLSPD 286

  Fly   233 QPN---RENAQCVRVKGGLYQTFQCDHRVLFICQ 263
            |||   .||........|.:....|..|:.::|:
Human   287 QPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCE 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 28/149 (19%)
CLEC11ANP_002966.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..106
Cell attachment site. /evidence=ECO:0000255 61..63
CLECT_tetranectin_like 177..321 CDD:153066 28/146 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..295 3/22 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.