DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and Clec1b

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_064369.1 Gene:Clec1b / 56760 MGIID:1913287 Length:229 Species:Mus musculus


Alignment Length:204 Identity:41/204 - (20%)
Similarity:65/204 - (31%) Gaps:53/204 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 KQLKALKVKMEGHFMDLHAKM--------EIKVKKLSLEKSLRKALNALQCSLDTRNVSSKVSLH 146
            |.|.|.|..:......|..|.        |||.|.....|          ||    ..::|...|
Mouse    59 KYLLAEKENLSATLQQLAKKFCQELIRQSEIKTKSTFEHK----------CS----PCATKWRYH 109

  Fly   147 PEFEKVGSRFFYIERHVKQNWFDAMTKCREMGGHLASPQNEEELHLISQKLDTESYWLDLSDLTD 211
            .:     |.:.:..|::  .|.::...|.|....|....::..|..|:::: |...|:.||.   
Mouse   110 GD-----SCYGFFRRNL--TWEESKQYCTEQNATLVKTASQSTLDYIAERI-TSVRWIGLSR--- 163

  Fly   212 HGQYISLVSGSKAPFLKW-----------NKGQPNRENAQCVRVKGGLYQTFQCDHRVLFICQAN 265
                    ..||..:: |           |......||..|..:..|......|..|...||:.|
Mouse   164 --------QNSKKDWM-WEDSSVLRKNGINLSGNTEENMNCAYLHNGKIHPASCKERHYLICERN 219

  Fly   266 QNRKKEDEI 274
            ....:.|::
Mouse   220 AGMTRVDQL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 23/126 (18%)
Clec1bNP_064369.1 CLECT_NK_receptors_like 102..218 CDD:153063 26/135 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.