Sequence 1: | NP_608540.1 | Gene: | CG2839 / 33244 | FlyBaseID: | FBgn0031273 | Length: | 826 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_064369.1 | Gene: | Clec1b / 56760 | MGIID: | 1913287 | Length: | 229 | Species: | Mus musculus |
Alignment Length: | 204 | Identity: | 41/204 - (20%) |
---|---|---|---|
Similarity: | 65/204 - (31%) | Gaps: | 53/204 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 90 KQLKALKVKMEGHFMDLHAKM--------EIKVKKLSLEKSLRKALNALQCSLDTRNVSSKVSLH 146
Fly 147 PEFEKVGSRFFYIERHVKQNWFDAMTKCREMGGHLASPQNEEELHLISQKLDTESYWLDLSDLTD 211
Fly 212 HGQYISLVSGSKAPFLKW-----------NKGQPNRENAQCVRVKGGLYQTFQCDHRVLFICQAN 265
Fly 266 QNRKKEDEI 274 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2839 | NP_608540.1 | CLECT | 147..263 | CDD:214480 | 23/126 (18%) |
Clec1b | NP_064369.1 | CLECT_NK_receptors_like | 102..218 | CDD:153063 | 26/135 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |