DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and zgc:174904

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001170922.1 Gene:zgc:174904 / 564690 ZFINID:ZDB-GENE-080204-76 Length:320 Species:Danio rerio


Alignment Length:162 Identity:48/162 - (29%)
Similarity:71/162 - (43%) Gaps:31/162 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   678 EEEKRKEEKRKREEEKRKKEERKREEEKRKEDERKREEEKRKEEEKRKEEERKEEERKKKETEEK 742
            |.:..|.||.:.|::|.:.|::|||.||    |:...|:|:.|.||||.|..||:...:||..:.
Zfish   102 ELQTAKREKSELEKDKSELEKKKRELEK----EKSELEKKKSELEKRKSELEKEKSELQKELLQL 162

  Fly   743 EKNMQEKCWVT-KKGTNKCKTCSTNEKGKKKCEVCWIRKDGEKKCKKSKKKKKPSYDDNTSYNYK 806
             |:...||.|| ...|....|.|       .|...|...:|  .|.......: |:.|:.:| .|
Zfish   163 -KDKVTKCEVTPAPRTTPAPTTS-------PCPQNWKHFNG--SCYFISVTTR-SWTDSQTY-CK 215

  Fly   807 SYGTELK-----------WSL---GWYYLYWW 824
            .||..|.           |.|   |::..:|:
Zfish   216 RYGGHLAIILTAEEQTFIWDLLPRGYWNAFWF 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480
zgc:174904NP_001170922.1 CLECT_DC-SIGN_like 186..316 CDD:153060 15/66 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.