DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and si:ch73-86n18.1

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001038504.2 Gene:si:ch73-86n18.1 / 564061 ZFINID:ZDB-GENE-141216-19 Length:263 Species:Danio rerio


Alignment Length:292 Identity:60/292 - (20%)
Similarity:107/292 - (36%) Gaps:84/292 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SYGSCNVFAENDIL---QDPLISSYDR------LKKL-GEMCLIDILPILENISEQQKEGYTANF 68
            :|.|...|.| ||.   ..|::||..:      :|.| |::.|:.::.:|.::        .||.
Zfish     6 NYTSLQEFTE-DISHCGNRPILSSQGKQGVHKGVKCLRGQVSLVLLIALLTSV--------CANI 61

  Fly    69 RIFNETQGILDRIEGHQEVNDKQ--LKALKVKMEGHFMDLHAKMEIKVKKLS--------LEKSL 123
            .:     |:|       .||.::  :.|..|..|.....|..|:....::.|        |.::.
Zfish    62 GL-----GVL-------LVNSRRSSISAEPVNSESEAATLSLKLTATQERFSRLCSEYTNLGQAC 114

  Fly   124 RKA-LNALQCSLDTRNVSSKVSLHPEFEKVGSRFFYIERHVKQNWFDAMTKCREMGGHLASPQNE 187
            .|: :....|..|..::|.|.              |.....|.:|..:...|..|||||....:.
Zfish   115 SKSVIKCRPCPEDWMHLSEKC--------------YYFSDDKLDWQHSKESCASMGGHLTILHSH 165

  Fly   188 EELHLISQKLDTES-----YWLDLSDLTDHG--QYISLVSGSKAPFLKWNKGQPNRENAQCVRVK 245
            |:.|.:........     :|:.|||....|  :::.....:|..:.:|.| :||...:      
Zfish   166 EQHHTLEAVARNHGGMDYHFWIGLSDTETEGVWKWVDNTVVNKTYWNEWEK-EPNNHRS------ 223

  Fly   246 GGLY-----------QTF---QCDHRVLFICQ 263
            ||::           :|:   .||.....||:
Zfish   224 GGVHGEDCAVLDSRSKTWFDVPCDFHYKRICE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 27/136 (20%)
si:ch73-86n18.1NP_001038504.2 CLECT_DC-SIGN_like 124..256 CDD:153060 32/153 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.