DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and lectin

DIOPT Version :10

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001188329.1 Gene:lectin / 560034 ZFINID:ZDB-GENE-070912-438 Length:152 Species:Danio rerio


Alignment Length:124 Identity:34/124 - (27%)
Similarity:54/124 - (43%) Gaps:9/124 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 EFEKVGSRFF-YIERHVKQNWFDAMTKCREMGGHLASPQN-EEELHLISQKLDTESYWLDLSDLT 210
            ::.:.|||.| |..  |..||..|...|:.:||:|.|.|| .|...|:|...::|.:::...|..
Zfish    27 QWSRFGSRCFRYFS--VPVNWVTAERNCQLLGGNLVSVQNGMENDFLLSLIPNSERFFIGGYDGE 89

  Fly   211 DHGQYISLVSGSKAPFLKWNKGQPNRENAQ-CVRV---KGGLYQTFQCDHRVLFICQAN 265
            |...:. ...||...:..|..|:||..|.: |:.:   ....:....|.....:||..|
Zfish    90 DEENWF-WSEGSSFGYTNWCSGEPNNMNTEHCLEINWTSDRCWNNLPCSTEQGYICAKN 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 32/120 (27%)
lectinNP_001188329.1 CLECT 34..146 CDD:153057 31/114 (27%)

Return to query results.
Submit another query.