DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and lectin-21Ca

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster


Alignment Length:280 Identity:99/280 - (35%)
Similarity:161/280 - (57%) Gaps:24/280 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFECATYFLFVFFSYGSCNVFAENDILQDPLISSYDRLKKLGEMCLIDILPILENISEQQKEGY- 64
            ||:.|.:||.||.:.|...:.|: |:.  |.:|: |:     |:||:::.|:|:.||...|..: 
  Fly     1 MFQHANFFLHVFMACGLYGIRAK-DVC--PRMST-DK-----EVCLVELAPVLKYISNNHKSHWN 56

  Fly    65 TANFRIFNETQGILDRIEGHQ-EVNDKQLKALKVKMEGHFMDLHAKMEIKVKKL-----SLEKSL 123
            :||....|||:..|.:|||.: |.||| :|.:...::..|..|.||:: .||.:     |||..|
  Fly    57 SANEVQVNETRKQLAKIEGQEKETNDK-IKVIHDNVDNEFNALSAKIK-NVKNIQRHLASLELQL 119

  Fly   124 RKALNALQCSLDTRNVSSKVSLHPEFEKVGSRFFYIERHVKQNWFDAMTKCREMGGHLASPQNEE 188
            ::...||..|::.:.|..|..:..:|:|:|.|.|:||:..|.:||.|.:.|.:||.||.:.|:|:
  Fly   120 QETKKALNLSVEAKKVMPKTEIPSQFQKIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSED 184

  Fly   189 ELHLISQKL-----DTESYWLDLSDLTDHGQYISLVSGSKAPFLKWNKGQPNRE-NAQCVRVKGG 247
            ||..|..:|     .:..:|||::|:...|::|||.:|...|||||:|.:|..: :.:||.::||
  Fly   185 ELDAIRTELKDINDGSHDFWLDINDIAKWGEFISLATGMNPPFLKWHKHRPQVQIHQRCVHLRGG 249

  Fly   248 LYQTFQCDHRVLFICQANQN 267
            .....:|..:.|||||...|
  Fly   250 EMMDGKCSEQFLFICQLAVN 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 46/121 (38%)
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 39/106 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448758
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 1 1.000 - - otm72280
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.