DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and lectin-24Db

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster


Alignment Length:366 Identity:98/366 - (26%)
Similarity:150/366 - (40%) Gaps:116/366 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ECATYFLFVFFSYGSCNVF------AEND----ILQDPLISSYDRLKKLGEMCLIDILPILENIS 57
            :|..|.|.      :||:.      .||.    :|:||       ..:.||.||..:.|:|::|.
  Fly     6 KCIVYLLV------ACNLVESRAESTENSRSVCLLKDP-------PNQCGEFCLSVLQPLLDHIV 57

  Fly    58 EQQKEGYTANFRIFNETQGILDRIE---------------------------------------- 82
            :.|::..|:.....|||||.||||:                                        
  Fly    58 KHQEQWNTSEALWLNETQGKLDRIQTQLAAQALSLEESAQKVPGDIKDRLDRMEHLQTTLQESLK 122

  Fly    83 --------------------GHQ---------EVNDKQLKALKVKMEGHFMDLHAKMEIKVKKL- 117
                                |.|         |....||:|||..|..:|....|::|.:.|.| 
  Fly   123 KMPAELDARLMKMENQQKTLGDQLENQINLTKESQQDQLEALKNAMPINFEMRLAQIEEQQKLLQ 187

  Fly   118 --------SLEKSLRK----------ALNALQCS--LDTRNVSSKVSLHPEFEKVGSRFFYIERH 162
                    ..|:.|:|          .|.|.|.:  :..:.:.:|| ..|:||::|||.|||...
  Fly   188 ETLKKIPEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKV-FWPKFERIGSRLFYINHK 251

  Fly   163 VKQNWFDAMTKCREMGGHLASPQNEEELHLISQKLDTESYWLDLSDLTDHGQYISLVSGSKAPFL 227
            ...:|..|:..||:|||::|:.:::|||..||.:||.:||||.::||.....|:|:.||.:..||
  Fly   252 DAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGINDLQSSNTYVSVASGREVEFL 316

  Fly   228 KWNKGQPN--RENAQCVRVKGGLYQTFQCDHRVLFICQANQ 266
            .||.|:||  .|:..||.:.........|..:...|||.::
  Fly   317 NWNAGEPNHGNEDENCVELIRSKMNDDPCHRKKHVICQTDK 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 46/117 (39%)
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 18/111 (16%)
NAT_SF <170..>229 CDD:302625 11/58 (19%)
CLECT 247..354 CDD:153057 39/106 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 1 1.000 - - otm72280
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.