DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and lectin-30A

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_652635.2 Gene:lectin-30A / 53541 FlyBaseID:FBgn0040097 Length:223 Species:Drosophila melanogaster


Alignment Length:267 Identity:68/267 - (25%)
Similarity:127/267 - (47%) Gaps:59/267 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FLFVFFSYGSCNVFAENDILQDPLISSYDRLKKLGEMCLIDILPILENISEQQKEGYTANFRIFN 72
            |:.|..::.|.:|.|..  .::||                    :::.::..|::.:|  |....
  Fly     6 FICVILAWASRDVLANK--TENPL--------------------LIDQVAINQQQWFT--FIALK 46

  Fly    73 ETQGILDRIEGHQEVNDKQLKALKVKMEGHFMDLHAKMEIKVKKLSLEKSLRKALNALQCSLDTR 137
            |              ::.|.|.:::           :..|:.:.::::..|..|||.||..:..:
  Fly    47 E--------------SEMQQKIVRI-----------ERSIEERLMAMQSKLAYALNELQTIMGNQ 86

  Fly   138 NVSS----KVS--LHPE-FEKVGSRFFYIERHVKQNWFDAMTKCREMGGHLASPQNEEELHLISQ 195
            :|.:    ::|  ::|. |:::|:|.||||:..|||||.|...||::|||:|:.::|:|.:.|..
  Fly    87 SVETLEKLRISHRINPALFQRMGTRRFYIEKENKQNWFGASNTCRQLGGHIATIRDEQEFNEIFS 151

  Fly   196 KLDTESYWLDLSDLTDHGQYISLVSGSKAPFLKWNKGQPNRENA-QCVRVKGGLYQTFQCDHRVL 259
            :.....:|:|::.:..:|.:.|.::|...||.||.|.:  |.|. .||.|.........|.:..|
  Fly   152 RAPAGVFWIDMNAMFKNGLFASSLTGRSPPFFKWKKEE--RGNKFDCVNVYNKEMYNENCFNTHL 214

  Fly   260 FICQANQ 266
            |||||.|
  Fly   215 FICQAEQ 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 42/117 (36%)
lectin-30ANP_652635.2 CLECT 118..218 CDD:153057 34/101 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448756
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22803
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.