DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and CLEC4A

DIOPT Version :10

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_057268.1 Gene:CLEC4A / 50856 HGNCID:13257 Length:237 Species:Homo sapiens


Alignment Length:135 Identity:37/135 - (27%)
Similarity:57/135 - (42%) Gaps:17/135 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LEKSLRKAL--NALQCSLDTRNVSSKV-SLHPE-FEKVGSRFFYIERHVKQNWFDAMTKCREMGG 179
            |||...|.|  ..|:|......|.... |..|: ::...|..::|... ..:|.|:...|..|..
Human    76 LEKKTTKELVHTTLECVKKNMPVEETAWSCCPKNWKSFSSNCYFISTE-SASWQDSEKDCARMEA 139

  Fly   180 HLASPQNEEELHLISQKLDTES-YWLDLSDLTD--HGQYISLVSGSKAPFLK----WNKGQPNRE 237
            ||.....:||...|.|.|..|| |::.|||...  |.|::     .:.|:.:    |:..:|:..
Human   140 HLLVINTQEEQDFIFQNLQEESAYFVGLSDPEGQRHWQWV-----DQTPYNESSTFWHPREPSDP 199

  Fly   238 NAQCV 242
            |.:||
Human   200 NERCV 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 28/104 (27%)
CLEC4ANP_057268.1 ITIM motif. /evidence=ECO:0000269|PubMed:20530286 5..10
CLECT_DC-SIGN_like 106..232 CDD:153060 28/105 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.