DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and CLEC4A

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_057268.1 Gene:CLEC4A / 50856 HGNCID:13257 Length:237 Species:Homo sapiens


Alignment Length:135 Identity:37/135 - (27%)
Similarity:57/135 - (42%) Gaps:17/135 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LEKSLRKAL--NALQCSLDTRNVSSKV-SLHPE-FEKVGSRFFYIERHVKQNWFDAMTKCREMGG 179
            |||...|.|  ..|:|......|.... |..|: ::...|..::|... ..:|.|:...|..|..
Human    76 LEKKTTKELVHTTLECVKKNMPVEETAWSCCPKNWKSFSSNCYFISTE-SASWQDSEKDCARMEA 139

  Fly   180 HLASPQNEEELHLISQKLDTES-YWLDLSDLTD--HGQYISLVSGSKAPFLK----WNKGQPNRE 237
            ||.....:||...|.|.|..|| |::.|||...  |.|::     .:.|:.:    |:..:|:..
Human   140 HLLVINTQEEQDFIFQNLQEESAYFVGLSDPEGQRHWQWV-----DQTPYNESSTFWHPREPSDP 199

  Fly   238 NAQCV 242
            |.:||
Human   200 NERCV 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 28/104 (27%)
CLEC4ANP_057268.1 ITIM motif. /evidence=ECO:0000269|PubMed:20530286 5..10
CLECT_DC-SIGN_like 106..232 CDD:153060 28/105 (27%)
Mannose binding. /evidence=ECO:0000269|PubMed:27015765, ECO:0007744|PDB:5B1X 195..197 0/1 (0%)
N-acetyl-D-glucosamine binding. /evidence=ECO:0000269|PubMed:27015765, ECO:0007744|PDB:5B1X 207..209
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.