DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG2839 and ly75

DIOPT Version :9

Sequence 1:	NP_608540.1	Gene:	CG2839 / 33244	FlyBaseID:	FBgn0031273	Length:	826	Species:	Drosophila melanogaster
Sequence 2:	XP_009304139.1	Gene:	ly75 / 504036	ZFINID:	ZDB-GENE-050309-166	Length:	1726	Species:	Danio rerio

Alignment Length:	125	Identity:	37/125 - (29%)
Similarity:	53/125 - (42%)	Gaps:	6/125 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly   148 EFEKVGSRFFYIERHVKQNWFDAMTKCREMGGHLASPQNEEELHLISQKLDTES-YWLDLSDLTD 211
            |.|.|..|.:.:.......|.:|...||..||.|.|..:.:||.....:.|..| .|:.::.| |
Zfish   220 EKEPVTGRCYQVVSTAVVTWHEARDACRSQGGDLLSLSSPQELQFFKDRKDLPSKLWIGVNHL-D 283

  Fly   212 HGQYISLVSGSKAPFLKWNKGQPNR---ENAQCVRVKGGL-YQTFQCDHRVLFICQANQN 267
            ..|......||...|..|..|.|.|   .:..|..:|..| :....|::|:.|||..|:|
Zfish   284 WMQGWQWSDGSPLSFAPWETGIPIRSLLSDEDCGVLKESLRFGAETCENRLPFICMKNEN 343

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG2839	NP_608540.1	CLECT	147..263	CDD:214480	34/119 (29%)
ly75	XP_009304139.1	RICIN	37..132	CDD:214672
		FN2	160..208	CDD:128373
		CLECT	227..340	CDD:153057	32/113 (28%)
		CLECT	368..485	CDD:153057
		CLECT	499..622	CDD:214480
		CLECT	644..796	CDD:214480
		CLECT	826..931	CDD:153057
		CLECT	958..1093	CDD:214480
		CLECT	1104..1220	CDD:214480
		CLECT	1242..1359	CDD:214480
		CLECT	1399..1509	CDD:153057
		CLECT	1534..1666	CDD:214480
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910