DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and Ly49s5

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001012767.1 Gene:Ly49s5 / 503662 RGDID:1359728 Length:277 Species:Rattus norvegicus


Alignment Length:252 Identity:48/252 - (19%)
Similarity:89/252 - (35%) Gaps:83/252 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 QLKALKVKMEGHFMDLHAKMEIKVKKLSLEK---------SLRKALNALQCSLDTRNV--SSKVS 144
            :|.|:.:.:...|...|.|.|       |:|         ::.|.:|..:.:|.|.:|  :|..:
  Rat    54 RLVAVAMLVTNIFQFSHEKHE-------LQKTRNRHPNCSTMEKDINLKEETLRTMSVECTSSNA 111

  Fly   145 LHPEFEKVGSRFF-----------YIERHVKQNWF-----------------DAMTKCREMGGHL 181
            |...|.:..:|::           :..|.|:.:||                 :....|:......
  Rat   112 LLDLFNREQNRWYKKTKTVLASPQHPARCVEMHWFCHGIKCYYFIMDIRTWHECKQTCQNYNLSF 176

  Fly   182 ASPQNEEELHLISQKLDTESYWLDLSDLTDHGQYISLVSGSKAPFLKWN------------KGQP 234
            ....:::||..:...:..:|||:.||       |.::..       :|:            ..:|
  Rat   177 LKIDDKDELKFLQDHIIRDSYWVGLS-------YNNIKK-------EWSWIDSSPLNCDLLACKP 227

  Fly   235 NRENAQCVRVK-GGLYQTFQCDHRVLFICQANQNRKKEDEINKNQGKPRIMEKERSK 290
            .::...|:... .||:.. .|..|.|.||:     |..|:|    ..|....||||:
  Rat   228 LQKTGYCIYFSMTGLHYD-DCGKRHLCICE-----KGMDKI----PAPLCSVKERSQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 24/156 (15%)
Ly49s5NP_001012767.1 Ly49 38..155 CDD:285577 21/107 (20%)
CLECT_NK_receptors_like 142..257 CDD:153063 21/134 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.