DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and Ly49i4

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001009495.1 Gene:Ly49i4 / 494204 RGDID:1549758 Length:280 Species:Rattus norvegicus


Alignment Length:287 Identity:50/287 - (17%)
Similarity:100/287 - (34%) Gaps:74/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FAENDILQDPLISSYDRLKK-----------------LGEMC---LIDILPILENISEQQKEGYT 65
            |.::.:.|:.:.|...|..|                 ||.:|   ::.:..::.||         
  Rat    13 FHKSSVFQNKVRSEDTRSAKENGHRESSVPWKLIVIALGILCSVLMVTVAALVTNI--------- 68

  Fly    66 ANFRIFNETQGILDRIEGHQEVNDKQLKALKVKMEGHFMDLHAKMEIKVKKLSLEKSLRKALNAL 130
              |:..||...:       |:..::|.....::     .|::.|.| .::.:|:|.....||   
  Rat    69 --FQYSNEKHEL-------QKTQNRQHNCSTME-----KDINLKEE-TLRNMSVESVHYNAL--- 115

  Fly   131 QCSLDTRN--------VSSKVSLHPEFEK---------VGSRFFYIERHVKQNWFDAMTKCREMG 178
               ||..|        .:..|...|:...         .|.:.:|....:: .|.:....|:...
  Rat   116 ---LDLINREQNRWYKKTKTVLASPQHTGGCDEMHWFCYGIKCYYFTMDIR-IWHECKQTCQNYS 176

  Fly   179 GHLASPQNEEELHLISQKLDTESYWLDLSDLTDHGQYISLVSGSKAPF-LKWNKGQPNRENAQCV 242
            .......:::||..:...:..::||:. |...:..:..|.:..|  || |.:......|:...|:
  Rat   177 LSFLKIDDKDELKFLQDHIIRDNYWIG-SSYNNKKKEWSWIDNS--PFNLDFVARNSLRKTGYCM 238

  Fly   243 RVK-GGLYQTFQCDHRVLFICQANQNR 268
            ... .||:.. .|..|.|.||:...::
  Rat   239 YFSMAGLHDD-DCGKRYLCICEKGMDK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 23/126 (18%)
Ly49i4NP_001009495.1 Ly49 40..158 CDD:285577 23/147 (16%)
CLECT_NK_receptors_like 145..260 CDD:153063 23/119 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.