DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and MBL2

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_000233.1 Gene:MBL2 / 4153 HGNCID:6922 Length:248 Species:Homo sapiens


Alignment Length:157 Identity:41/157 - (26%)
Similarity:67/157 - (42%) Gaps:28/157 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 SLEKSLRKALNA--------LQCSLDTRNVSSKVSLHPEFEKVGSRFFYIERHVKQNWFDAMTKC 174
            ||..|.||||..        |..||.              ::||::||.....: ..:......|
Human   106 SLAASERKALQTEMARIKKWLTFSLG--------------KQVGNKFFLTNGEI-MTFEKVKALC 155

  Fly   175 REMGGHLASPQNEEELHLISQKLDTESYWLDLSDLTDHGQYISLVSGSKAPFLKWNKGQPNR--E 237
            .:....:|:|:|..|...| |.|..|..:|.::|....||::.| :|::..:..||:|:||.  .
Human   156 VKFQASVATPRNAAENGAI-QNLIKEEAFLGITDEKTEGQFVDL-TGNRLTYTNWNEGEPNNAGS 218

  Fly   238 NAQCV-RVKGGLYQTFQCDHRVLFICQ 263
            :..|| .:|.|.:....|....|.:|:
Human   219 DEDCVLLLKNGQWNDVPCSTSHLAVCE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 30/118 (25%)
MBL2NP_000233.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..113 3/6 (50%)
CLECT_collectin_like 136..246 CDD:153061 29/113 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.