DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and CLEC12B

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001123470.1 Gene:CLEC12B / 387837 HGNCID:31966 Length:276 Species:Homo sapiens


Alignment Length:225 Identity:42/225 - (18%)
Similarity:84/225 - (37%) Gaps:64/225 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 FMDLHAKMEIKVKKLS-LEKSLRKALNALQCSLDTRNVSSKVSLHPEF------------EKVGS 154
            |:.:...:....:||| |:|::::..:.|...|..   |:.:|:..||            |::..
Human    64 FLQISNDINSDSEKLSQLQKTIQQQQDNLSQQLGN---SNNLSMEEEFLKSQISSVLKRQEQMAI 125

  Fly   155 RF---------------------------FYIERHVKQNWFDAMTKCREMGGHLASPQN-EEELH 191
            :.                           :|...:.::.|.::...|.:....|....: ||:..
Human   126 KLCQELIIHTSDHRCNPCPKMWQWYQNSCYYFTTNEEKTWANSRKDCIDKNSTLVKIDSLEEKDF 190

  Fly   192 LISQKLDTES-YWLDLS-DLTDHGQY--------ISLVSGSKAPFLKWNKGQPNRENAQCVRV-K 245
            |:||.|...| :||.|| |.:....:        .||.|..:...:..:||        |... |
Human   191 LMSQPLLMFSFFWLGLSWDSSGRSWFWEDGSVPSPSLFSTKELDQINGSKG--------CAYFQK 247

  Fly   246 GGLYQTFQCDHRVLFICQANQNRKKEDEIN 275
            |.:|.: :|...:.:||:......|.::::
Human   248 GNIYIS-RCSAEIFWICEKTAAPVKTEDLD 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 30/166 (18%)
CLEC12BNP_001123470.1 ITIM motif 5..10
CLECT_NK_receptors_like 143..265 CDD:153063 28/130 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.