Sequence 1: | NP_608540.1 | Gene: | CG2839 / 33244 | FlyBaseID: | FBgn0031273 | Length: | 826 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001123470.1 | Gene: | CLEC12B / 387837 | HGNCID: | 31966 | Length: | 276 | Species: | Homo sapiens |
Alignment Length: | 225 | Identity: | 42/225 - (18%) |
---|---|---|---|
Similarity: | 84/225 - (37%) | Gaps: | 64/225 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 103 FMDLHAKMEIKVKKLS-LEKSLRKALNALQCSLDTRNVSSKVSLHPEF------------EKVGS 154
Fly 155 RF---------------------------FYIERHVKQNWFDAMTKCREMGGHLASPQN-EEELH 191
Fly 192 LISQKLDTES-YWLDLS-DLTDHGQY--------ISLVSGSKAPFLKWNKGQPNRENAQCVRV-K 245
Fly 246 GGLYQTFQCDHRVLFICQANQNRKKEDEIN 275 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2839 | NP_608540.1 | CLECT | 147..263 | CDD:214480 | 30/166 (18%) |
CLEC12B | NP_001123470.1 | ITIM motif | 5..10 | ||
CLECT_NK_receptors_like | 143..265 | CDD:153063 | 28/130 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |