DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and Colec11

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:XP_006240022.1 Gene:Colec11 / 366588 RGDID:1309678 Length:277 Species:Rattus norvegicus


Alignment Length:162 Identity:39/162 - (24%)
Similarity:68/162 - (41%) Gaps:21/162 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 KMEIKVKKLSLE-KSLRKALNALQCSLDTRNVSSKVSLHPEFEKVGSRFFYIERHVKQNWFDAMT 172
            :|:.:|.:|:.| |.::.||.:.......|...||:.|..:.||              .:.||..
  Rat   124 EMDNQVTQLTTEIKFIKNALPSPAAVAGVRETESKIYLLVKEEK--------------RYADAQL 174

  Fly   173 KCREMGGHLASPQNEEELHLISQKL---DTESYWLDLSDLTDHGQYISLVSGSKAPFLKWNKGQP 234
            .|:..||.|:.|::|....|::..|   .....::.::||...|.::.........|.||..|:|
  Rat   175 SCQGRGGTLSMPKDEAANGLMASYLAQAGLARVFIGINDLEREGAFVYSDRSPMQTFNKWRSGEP 239

  Fly   235 NR--ENAQCVR-VKGGLYQTFQCDHRVLFICQ 263
            |.  :...||. |..|.:....|...:.|:|:
  Rat   240 NNAYDEEDCVEMVASGGWNDVACHITMYFMCE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 27/121 (22%)
Colec11XP_006240022.1 Collagen 40..95 CDD:189968
CLECT_collectin_like 157..272 CDD:153061 31/129 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.