DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and CG7763

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster


Alignment Length:271 Identity:68/271 - (25%)
Similarity:116/271 - (42%) Gaps:83/271 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ECATYFLFVFFSYGSCNVFAENDILQDPLISSYDRLKKLGEMCLIDILPILENISEQQKEGYTAN 67
            :||.|      .||..|          |.|:|...|::..|.|                |...|.
  Fly    30 QCAAY------CYGVLN----------PCIASMGNLQRRVEAC----------------EAAVAI 62

  Fly    68 FRIFNETQGILDRIEGHQEVNDKQLKALKVKMEGHFMDLHAKMEIKVKKLSLEKSLRKALNALQC 132
            .||               .:||::|.           :......::::..:..:.|.....|:..
  Fly    63 ARI---------------ALNDRRLD-----------NFGTSTNLQLENQNTSQQLLTHGTAMGR 101

  Fly   133 SLDTRNVSSKVSLHPEFEKVGSRFFYIERHVKQNWFDAMTKCREMGGHLASPQNEEELHLISQKL 197
            .|:...:         |:::||:::|||:..|.||.||:.||.:|||||||.|::|||...:.:|
  Fly   102 KLEENEI---------FQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQL 157

  Fly   198 D-TESYWLDLSDLTDHGQYISLVSGSKAPFLKWNKGQPNRENAQCVRVKGGLYQTF--------- 252
            : ...||:|:::..:..:::|:..||||.||.|..|:|.:: .:||.::     ||         
  Fly   158 NGLNRYWIDVTNQFNESEFVSVTKGSKANFLSWADGEPTKD-GECVDIR-----TFNGKTTMNDN 216

  Fly   253 QCDHRVLFICQ 263
            .|...:.|||:
  Fly   217 SCFANLYFICE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 45/125 (36%)
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 43/118 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448811
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.