DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and CG15818

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster


Alignment Length:300 Identity:88/300 - (29%)
Similarity:148/300 - (49%) Gaps:51/300 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFECATYFLFVF---FSYGSCNVFAEND----ILQDPLISSYDRLKKLGEMCLIDILPILENISE 58
            ||......|..|   :.|||.....|..    :|.||       ..:..|.|:..:.|:::::|:
  Fly     1 MFSSTRIILCAFLLLYPYGSLIEAQEGRRYVCLLSDP-------PNQCSEYCVSALQPVIDHLSK 58

  Fly    59 QQKEGYTANFRIFNETQGILDRIEGHQEVNDKQLKALKVKMEGH--FM-----------DLHAKM 110
            :|::......:: |.:...||:||       .||.|.::::|..  |:           ||..|:
  Fly    59 EQQDWGACEVKL-NGSVAKLDKIE-------DQLTATQIQIEAQQAFLVNNISKAIKTEDLEQKL 115

  Fly   111 -EIKVKKLSLEKSLR-------KALNALQCSLDTRNVSSKVSLHPEFEKVGSRFFYIERHVKQNW 167
             :|:..:.:|...|:       ..|.|:|.:|.  ::..|:.|. .::::|||:||||.:::.||
  Fly   116 KDIEGNQTALSNQLKDGQKRTENQLTAIQKTLS--DIERKLVLQ-RYQQIGSRYFYIEHNLQVNW 177

  Fly   168 FDAMTKCREMGGHLASPQNEEELHLISQKLDTESYWLDLSDLTDHGQYISLVSGSKAPFLKWNKG 232
            ..|..:|.|||||||:.||.||.:.|..:|:..:|||.::||...|::|||.||.:|.:.||.|.
  Fly   178 RTAEQRCIEMGGHLAAFQNAEEYNAIVGQLNKANYWLGVNDLAKQGEFISLASGKRATYFKWRKN 242

  Fly   233 QP--NRENAQCVRVKG--GLYQTFQCDHRVL-FICQANQN 267
            :|  |.....|..|.|  .:.....|...|: ||||::.:
  Fly   243 EPKYNNPTQHCAYVFGHENIMIVLSCTTDVMHFICQSDSD 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 48/120 (40%)
CG15818NP_609116.1 CLECT 164..278 CDD:153057 47/113 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448778
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 1 1.000 - - otm72280
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.