DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and lectin-37Da

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster


Alignment Length:140 Identity:33/140 - (23%)
Similarity:56/140 - (40%) Gaps:21/140 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 VSLHPEFEKVGSRFFYIERHVKQNWFDAMTKCREMGGHLASPQNEEELHLISQKL----DTESYW 203
            |.:.| |.|: :..:|:....|.||:.|...||.:...|.:.:..||...|:..|    |...:|
  Fly    38 VDMTP-FIKI-NESYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHW 100

  Fly   204 LDLSDLTDHGQYISLVSGSKAPFLKWNKGQPNRENAQ--CVRVKGGLY---QTFQCDHR------ 257
            ...:||...|.:....:.......:|...||:....:  |:.: |.:|   ..||.:.|      
  Fly   101 TSGNDLGKTGTHYWFSNAQLVTIKRWAPKQPDNAGGREHCIHL-GYIYGYSTEFQLNDRPCHNHA 164

  Fly   258 ---VLFICQA 264
               ..:||:|
  Fly   165 SSLFKYICEA 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 30/133 (23%)
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 27/124 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448831
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.