DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and lectin-37Db

DIOPT Version :10

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001014490.1 Gene:lectin-37Db / 3346221 FlyBaseID:FBgn0053533 Length:150 Species:Drosophila melanogaster


Alignment Length:124 Identity:49/124 - (39%)
Similarity:71/124 - (57%) Gaps:12/124 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 KVGSRFFYIERHVKQNWFDAMTKCREMGGHLASPQNEEELHLISQKL-DTESYWLDLSDLTDHGQ 214
            ::|.:.:||.. .|.|||:|...||:.||.|.:.::.|||.|:|..| ...||||.::||.:.|.
  Fly    30 EIGEKQYYISL-AKTNWFEASNHCRQNGGFLLNLESREELELLSPHLHPAYSYWLSINDLGERGV 93

  Fly   215 YISLVSGSKAPFLKWNKGQPNRENA--QCVRVKGGLYQT-FQ-----CDHRVLFICQAN 265
            |:|..:|.:||||.|:.|:|:..:.  :||.:  .|..| ||     |...|.||||.|
  Fly    94 YVSEATGLEAPFLNWSAGEPDNSSGYDRCVEL--WLSTTSFQMNDLPCYSSVAFICQLN 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 46/120 (38%)
lectin-37DbNP_001014490.1 CLECT 34..148 CDD:153057 45/116 (39%)

Return to query results.
Submit another query.