DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and lectin-21Cb

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster


Alignment Length:277 Identity:116/277 - (41%)
Similarity:164/277 - (59%) Gaps:42/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFECATYFLFVFFSYGSCNVFAENDILQD---PLISSYDRLKKLGEMCLIDILPILENI-SEQQK 61
            ||:..||||::.       |..:....|:   |.:|..:||:|.||..|::..|:|:.| ....|
  Fly     1 MFKYDTYFLYLI-------VLLDPQGAQENNCPKVSLSERLEKRGEFSLVEFDPLLKFIVKNPHK 58

  Fly    62 EGYTANFRIFNETQGILDRIEGHQE--------VNDKQLKALKVKMEGHFMDLHAKMEIKVKKLS 118
            |       :..|.:|::    ||.|        |...|.|||.     :::|||:|:|.      
  Fly    59 E-------LLGEIEGLV----GHTENKLQPMKSVIPNQSKALL-----NYLDLHSKLEY------ 101

  Fly   119 LEKSLRKALNALQCSLDTRNVSSKVSLHPEFEKVGSRFFYIERHVKQNWFDAMTKCREMGGHLAS 183
            |:.:|:||:|:|||||....|.|....||||:|:|||:|||||||:||||||..|||.||||||:
  Fly   102 LDAALQKAINSLQCSLKNTKVMSTGKPHPEFQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLAT 166

  Fly   184 PQNEEELHLISQKLDTESYWLDLSDLTDHGQYISLVSGSKAPFLKWNKGQPNREN-AQCVRVKGG 247
            ||:|:||:||.::|:...:|||:|:|.|..|||||.:|.:..:|||..|:|.:.: |.|..:..|
  Fly   167 PQDEDELYLIRKQLEARWFWLDISNLVDKDQYISLATGKEVSYLKWRHGEPKKSSTANCAYLYAG 231

  Fly   248 LYQTFQCDHRVLFICQA 264
            .|.|:||..|..|||||
  Fly   232 DYYTYQCSDRNFFICQA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 64/116 (55%)
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 59/109 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448749
Domainoid 1 1.000 54 1.000 Domainoid score I11184
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 1 1.000 - - otm72280
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.