DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and Klri2

DIOPT Version :10

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_796129.2 Gene:Klri2 / 320407 MGIID:2443965 Length:248 Species:Mus musculus


Alignment Length:155 Identity:32/155 - (20%)
Similarity:61/155 - (39%) Gaps:24/155 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 EKSLRKALNALQCSLDTRNVSSKVSLHPEFEKVGSRFFYIERHVKQNWFDAMTKCREMGGHLASP 184
            ||..|| .:.|....|..:.||......::...|:.|:.:.|...:.|.::.:.|.|:..||.  
Mouse   108 EKQSRK-FSLLDPLCDRNDDSSCDFCSSDWIAFGNNFYCVFRENSKTWVESQSACEELNSHLV-- 169

  Fly   185 QNEEELHLISQKLDTESYWLDLSDLTDHGQYISLVSGSKAPFLKWNK---------GQPNRENAQ 240
                   :|..|.:.|:..|...|    |..:..:.|:.:..| |..         ....::|..
Mouse   170 -------IIDSKAEVENLLLFEMD----GWILHRMDGTNSSRL-WGNDIKIRNTLMNDSEKKNHS 222

  Fly   241 CVRVKGGLYQTFQCDHRVLFICQAN 265
            |..::|.::...:|..:..:||:.|
Mouse   223 CHYLRGNIFMPDECSAKKTYICEFN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 22/124 (18%)
Klri2NP_796129.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..44
CLECT_NK_receptors_like 132..245 CDD:153063 22/126 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.