DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and CG12111

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster


Alignment Length:144 Identity:37/144 - (25%)
Similarity:70/144 - (48%) Gaps:21/144 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 VSSKVSLHPEFEKVGSRFFYIERHVKQNWFDAMTKCREMGGHLASPQNEEELHLISQKL------ 197
            :.|::...| |.::|..::|||...|.|||.|...||.|..||||.:::.|:..:.:.:      
  Fly    39 IPSEIDTTP-FVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFK 102

  Fly   198 DTESYWLDLSDLTDHGQYISLVSGSKAPFLKWN--KGQPNR--ENAQCVRVKGGLYQTFQ----- 253
            :.:.:|:..:||...|.:..:.:|....:..||  |..|:.  .|..||.    ::.|.:     
  Fly   103 NNDYFWISGNDLGTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGNENCVH----MFATREMINDA 163

  Fly   254 -CDHRVLFICQANQ 266
             |..::|::|:|.:
  Fly   164 NCKIQMLYVCEATE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 34/131 (26%)
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 31/122 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448801
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.