DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and Cd209l1

DIOPT Version :10

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:XP_221808.5 Gene:Cd209l1 / 304197 RGDID:1564571 Length:207 Species:Rattus norvegicus


Alignment Length:114 Identity:26/114 - (22%)
Similarity:53/114 - (46%) Gaps:6/114 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GSRFFYIERHVKQNWFDAMTKCREMGGHLASPQNEEELHLISQKLDTE-SYWLDLSDLTDHGQYI 216
            |:.:|:  ...::.|.:::..|::||..|...::.||...:.:....: :.|:.|||..:..|::
  Rat    89 GNCYFF--STFQKKWKESVIACKDMGAQLVVIKSYEEQSFLQRTSKMKGNTWIGLSDSQEEDQWL 151

  Fly   217 SLVSGSKAPFLK-WNKGQPNR-ENAQCVRVKGGLYQTFQCDHRVLFICQ 263
             .|.||...:.. |:.|:||. .:..||......:....|.....:||:
  Rat   152 -WVDGSPLQWRNYWSAGEPNNLYDEDCVEFSSYGWNDISCSFEKFWICK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 25/112 (22%)
Cd209l1XP_221808.5 CLECT_DC-SIGN_like 80..200 CDD:153060 26/114 (23%)

Return to query results.
Submit another query.