DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and Colec10

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001124013.1 Gene:Colec10 / 299928 RGDID:1307149 Length:277 Species:Rattus norvegicus


Alignment Length:148 Identity:36/148 - (24%)
Similarity:70/148 - (47%) Gaps:9/148 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 RKALNALQCSLDTRNVSSKV--SLHPEFEKVGSRFFYIERHVKQNWFDAMTKCREMGGHLASPQN 186
            ||.:..|..|:.....|.|.  ::.....:...:|:||.:..| |:.:::|.||..||.||.|::
  Rat   125 RKVVGQLDISVARLKTSMKFIKNVIAGIRETEEKFYYIVQEEK-NYRESLTHCRIRGGMLAMPKD 188

  Fly   187 EEELHLISQKLDTESY---WLDLSDLTDHGQYISLVSGSKAPFLKWNKGQPNRE--NAQCVR-VK 245
            |....||:..:....:   ::.::||...|||:...:.....:..|.:|:|:..  :..||. :.
  Rat   189 EVVNTLIADYVAKSGFFRVFIGVNDLEKEGQYVFTDNTPLQNYSNWKEGEPSDPYGHEDCVEMLS 253

  Fly   246 GGLYQTFQCDHRVLFICQ 263
            .|.:...:|...:.|:|:
  Rat   254 SGRWNDTECHLTMYFVCE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 29/121 (24%)
Colec10NP_001124013.1 Collagen 45..94 CDD:189968
CLECT_collectin_like 157..272 CDD:153061 30/116 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.